Property Summary

NCBI Gene PubMed Count 29
PubMed Score 10.74
PubTator Score 17.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.270 1.7e-02
malignant mesothelioma 1.300 1.1e-04
astrocytic glioma 1.100 2.4e-02
psoriasis -1.100 4.1e-03
osteosarcoma 2.136 1.4e-07
glioblastoma 1.200 7.3e-03
group 4 medulloblastoma 1.300 5.1e-03
medulloblastoma, large-cell 1.300 2.5e-04
Breast cancer 2.700 2.8e-02
ovarian cancer -1.100 2.8e-02
pituitary cancer -1.700 1.4e-03
dermatomyositis 1.200 2.1e-03

Gene RIF (19)

PMID Text
23153325 This study validates Tat-SF1 as an HDF in CD4+ T cell-derived SupT1 cells.
23153325 Knockdown of HIV-1 Tat specific factor 1 (HTATSF1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells and in CD4+ SupT1 cells
21282347 these findings suggest that Tat-SF1 functions independently in transcription and splicing of cellular genes.
19966273 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
19479034 Tat-SF1 is not required for regulating HIV-1 transcription, but is required for maintaining the ratios of different classes of HIV-1 transcripts.
18187620 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
18187620 Knockdown of HIV-1 Tat specific factor 1 (HTATSF1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells and in CD4+ SupT1 cells
16512786 Intracellular HIV-1 Tat protein represses constitutive LMP2 transcription increasing proteasome activity by interfering with the binding of IRF-1 to STAT1
15564463 phosphorylated by P-TEFb kinase during HIV-1 transcription in Tat/TAR dependent manner
15050687 These results support the notion that Tat-induced neuropathogenesis is mediated by multiple mechanisms involving both intracellular and extracellular Tat protein.
11780068 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
11420046 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
10964778 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
10913173 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
10454543 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
10393184 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
9765201 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
9649438 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
8849451 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150

AA Sequence

MSGTNLDGNDEFDEQLRMQELYGDGKDGDTQTDAGGEPDSLGQQPTDTPYEWDLDKKAWFPKITEDFIAT      1 - 70
YQANYGFSNDGASSSTANVEDVHARTAEEPPQEKAPEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGL     71 - 140
PPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYK    141 - 210
LHVEVAKFQLKGEYDASKKKKKCKDYKKKLSMQQKQLDWRPERRAGPSRMRHERVVIIKNMFHPMDFEDD    211 - 280
PLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGT    281 - 350
TDYQVEETSREREERLRGWEAFLNAPEANRGLRRSDSVSASERAGPSRARHFSEHPSTSKMNAQETATGM    351 - 420
AFEEPIDEKKFEKTEDGGEFEEGASENNAKESSPEKEAEEGCPEKESEEGCPKRGFEGSCSQKESEEGNP    421 - 490
VRGSEEDSPKKESKKKTLKNDCEENGLAKESEDDLNKESEEEVGPTKESEEDDSEKESDEDCSEKQSEDG    491 - 560
SEREFEENGLEKDLDEEGSEKELHENVLDKELEENDSENSEFEDDGSEKVLDEEGSEREFDEDSDEKEEE    561 - 630
EDTYEKVFDDESDEKEDEEYADEKGLEAADKKAEEGDADEKLFEESDDKEDEDADGKEVEDADEKLFEDD    631 - 700
DSNEKLFDEEEDSSEKLFDDSDERGTLGGFGSVEEGPLSTGSSFILSSDDDDDDI                   701 - 755
//

Text Mined References (40)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23153325 2012 Impact of sustained RNAi-mediated suppression of cellular cofactor Tat-SF1 on HIV-1 replication in CD4+ T cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21282347 2011 Identification of Tat-SF1 cellular targets by exon array analysis reveals dual roles in transcription and splicing.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19952111 2009 DSIF, the Paf1 complex, and Tat-SF1 have nonredundant, cooperative roles in RNA polymerase II elongation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19479034 2009 Tat-SF1 is not required for Tat transactivation but does regulate the relative levels of unspliced and spliced HIV-1 RNAs.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16512786 2006 Intracellular HIV-1 Tat protein represses constitutive LMP2 transcription increasing proteasome activity by interfering with the binding of IRF-1 to STAT1.
15905670 2005 Soluble HIV-1 gp120 enhances HIV-1 replication in non-dividing CD4+ T cells, mediated via cell signaling and Tat cofactor overexpression.
15772651 2005 The DNA sequence of the human X chromosome.
15564463 2004 Coordination of transcription factor phosphorylation and histone methylation by the P-TEFb kinase during human immunodeficiency virus type 1 transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485897 2004 FF domains of CA150 bind transcription and splicing factors through multiple weak interactions.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15050687 2004 Proliferation inhibition of astrocytes, neurons, and non-glial cells by intracellularly expressed human immunodeficiency virus type 1 (HIV-1) Tat protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780068 2001 Stimulatory effect of splicing factors on transcriptional elongation.
11420046 2001 Nef triggers a transcriptional program in T cells imitating single-signal T cell activation and inducing HIV virulence mediators.
10964778 2000 An in vitro transcription system that recapitulates equine infectious anemia virus tat-mediated inhibition of human immunodeficiency virus type 1 Tat activity demonstrates a role for positive transcription elongation factor b and associated proteins in the mechanism of Tat activation.
10913173 2000 Relief of two built-In autoinhibitory mechanisms in P-TEFb is required for assembly of a multicomponent transcription elongation complex at the human immunodeficiency virus type 1 promoter.
10454543 1999 Tat-SF1 protein associates with RAP30 and human SPT5 proteins.
10393184 1999 A novel RNA polymerase II-containing complex potentiates Tat-enhanced HIV-1 transcription.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9710584 1998 CUS2, a yeast homolog of human Tat-SF1, rescues function of misfolded U2 through an unusual RNA recognition motif.
9649438 1998 Transcription elongation factor P-TEFb mediates Tat activation of HIV-1 transcription at multiple stages.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.