Property Summary

NCBI Gene PubMed Count 40
PubMed Score 51.31
PubTator Score 38.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
astrocytic glioma -2.300 7.6e-03
psoriasis -1.600 1.4e-02
cutaneous lupus erythematosus 1.100 9.2e-03
glioblastoma -2.300 4.3e-05
oligodendroglioma -1.200 2.5e-13
osteosarcoma 1.039 2.0e-02
medulloblastoma -2.400 2.1e-06
atypical teratoid / rhabdoid tumor -1.900 2.8e-05
medulloblastoma, large-cell -2.600 9.3e-05
hereditary spastic paraplegia -1.103 4.8e-03
juvenile dermatomyositis 1.132 3.1e-07
acute quadriplegic myopathy 1.309 8.8e-05
tuberculosis and treatment for 3 months -2.100 1.1e-05
non-small cell lung cancer -1.170 3.6e-08
intraductal papillary-mucinous neoplasm ... 1.400 1.9e-02
colon cancer 3.300 2.1e-03
breast carcinoma 1.400 5.1e-03
Breast cancer 3.700 4.2e-02
pediatric high grade glioma -1.900 1.5e-05
pilocytic astrocytoma -1.600 1.7e-04
lung adenocarcinoma 1.162 6.0e-05
Pick disease -1.100 1.5e-02
ductal carcinoma in situ 1.400 3.8e-04
invasive ductal carcinoma 1.500 5.0e-03
ovarian cancer 1.600 2.4e-03
chronic rhinosinusitis -1.594 2.2e-02
cystic fibrosis and chronic rhinosinusit... -1.591 3.4e-02

Protein-protein Interaction (4)

Gene RIF (15)

PMID Text
25645927 HSP105 depletion disrupts the integration of protein phosphatase 2A into the beta-catenin degradation complex, favoring the hyperphosphorylation and degradation of beta-catenin.
24512910 About 25% of patients with stages II-III colorectal tumors with microsatellite instability have an excellent response to chemotherapy, due to large, biallelic deletions in the T(17) intron repeat of HSP110 in tumor DNA.
24318877 we measured the binding of human Hsp72 (HSPA1A) to BAG1, BAG2, BAG3, and the unrelated NEF Hsp105. These studies revealed a clear hierarchy of affinities: BAG3 > BAG1 > Hsp105 >> BAG2.
24157810 A receiver operating characteristic curve constructed with HSP105 and TIM gave a sensitivity of 54.3% and 95% (38/40) specificity in discriminating esophageal squamous cell carcinoma from matched controls.
23737532 HSPH1 and HSPH2 are bona fide chaperones on their own that collaborate with DNAJA1 and DNAJB1 to hydrolyze ATP and unfold polypeptides and HSPA1A and HSPH1 formed a powerful molecular machinery.
22901192 High HSP105 expression is associated with Barrett's esophagus.
22712230 It restricts aggregation of denaturated proteins,plays a role in protein folding in cytoplasms,and enhance expression of hsp70 in cell nucleus.(review)
22505710 The Hsp105-mediated multilevel regulation of DeltaF508 CFTR folding and quality control provides new opportunities to understand how chaperone machinery regulates the homeostasis and functional expression of misfolded proteins in the cell.
22190034 HIV-1 gp120 is identified to have a physical interaction with heat shock 105kDa/110kDa protein 1 (HSPH1; HSP105) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21860023 A direct correlation between HSP105 expression and lymphoma aggressiveness was also apparent.
20542028 Hsp105alpha and Hsp105beta suppressed the expanded polyQ tract-induced protein aggregation and apoptosis through the induction of Hsp70.
19476517 HSP 105 is thought to be a more relevant tumor-associated antigen in malignant melanoma than is HSP 70.
18477890 HSP105 analysis may be a helpful tool as a poor prognostic indicator and as a diagnostic aid in problematic lesions.
18083346 HSP105 appears to chaperone the responses to endoplasmic reticulum (ER) stress through its interactions with GRP78 and GSK3, and without HSP105 cell death following ER stress proceeds by a non-caspase-3-dependent process.
14534695 Heat shock protein 105 is overexpressed in a variety of human tumors

AA Sequence

MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNTVSNFKRF      1 - 70
HGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDC     71 - 140
VISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAFQV    141 - 210
SACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSN    211 - 280
STDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAV    281 - 350
KERIAKFFGKDISTTLNADEAVARGCALQCAILSPAFKVREFSVTDAVPFPISLIWNHDSEDTEGVHEVF    351 - 420
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIGRFVVQNVSAQKDGEKSRVKVKVRVNTHGIF    421 - 490
TISTASMVEKVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPEL    491 - 560
TSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKE    561 - 630
RNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGT    631 - 700
PVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQA    701 - 770
KKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPH    771 - 840
QNGECYPNEKNSVNMDLD                                                        841 - 858
//

Text Mined References (50)

PMID Year Title
25645927 2015 HSP105 recruits protein phosphatase 2A to dephosphorylate ?-catenin.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24512910 2014 Patients with colorectal tumors with microsatellite instability and large deletions in HSP110 T17 have improved response to 5-fluorouracil–based chemotherapy.
24318877 2014 Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24157810 2014 Identification of tumor antigens that elicit a humoral immune response in the sera of Chinese esophageal squamous cell carcinoma patients by modified serological proteome analysis.
23737532 2013 Hsp110 is a bona fide chaperone using ATP to unfold stable misfolded polypeptides and reciprocally collaborate with Hsp70 to solubilize protein aggregates.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22901192 2012 Prevalence and pathogenesis of Barrett's esophagus in Luoyang, China.
22712230 2012 [Structure and function of HSP105 family proteins].
22505710 2012 Human heat shock protein 105/110 kDa (Hsp105/110) regulates biogenesis and quality control of misfolded cystic fibrosis transmembrane conductance regulator at multiple levels.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21860023 2011 Serological identification of HSP105 as a novel non-Hodgkin lymphoma therapeutic target.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20542028 2010 Hsp105 reduces the protein aggregation and cytotoxicity by expanded-polyglutamine proteins through the induction of Hsp70.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19476517 2009 Expression of heat shock protein 105 and 70 in malignant melanoma and benign melanocytic nevi.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18477890 2008 Differential expression of heat shock protein 105 in melanoma and melanocytic naevi.
18083346 2008 HSP105 interacts with GRP78 and GSK3 and promotes ER stress-induced caspase-3 activation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17024176 2006 A novel HSF1-mediated death pathway that is suppressed by heat shock proteins.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16232202 2005 DNA vaccination of HSP105 leads to tumor rejection of colorectal cancer and melanoma in mice through activation of both CD4 T cells and CD8 T cells.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14733918 2004 Screening of Hsp105alpha-binding proteins using yeast and bacterial two-hybrid systems.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14534695 Heat shock protein 105 is overexpressed in a variety of human tumors.
12952910 2003 Come forth CD1d: Hsp110 in the regulation of intestinal epithelial CD1d expression.
12853125 2003 Inhibitory actions of genistein in human breast cancer (MCF-7) cells.
12749852 2003 Identification of alpha-tubulin as an hsp105alpha-binding protein by the yeast two-hybrid system.
12558502 2003 Protein kinase CK2 phosphorylates Hsp105 alpha at Ser509 and modulates its function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10865058 2000 The distribution and localization of hsp110 in brain.
10772927 2000 Phosphorylation of the 105-kDa heat shock proteins, HSP105alpha and HSP105beta, by casein kinase II.
9931472 1999 Molecular cloning, expression and localization of human 105 kDa heat shock protein, hsp105.
9675148 1998 Association of HSP105 with HSC70 in high molecular mass complexes in mouse FM3A cells.
9610721 1998 Characterization of human colon cancer antigens recognized by autologous antibodies.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.