Property Summary

NCBI Gene PubMed Count 50
PubMed Score 52.42
PubTator Score 38.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.309 8.8e-05
adult high grade glioma -1.100 8.9e-03
astrocytic glioma -2.000 3.6e-03
Astrocytoma, Pilocytic -1.500 5.0e-06
atypical teratoid / rhabdoid tumor -1.100 9.7e-05
Breast cancer 3.700 4.2e-02
breast carcinoma 1.400 5.1e-03
chronic rhinosinusitis -1.354 5.0e-02
colon cancer 3.300 2.1e-03
cutaneous lupus erythematosus 1.100 9.2e-03
cystic fibrosis and chronic rhinosinusit... -1.198 4.6e-02
ductal carcinoma in situ 1.400 3.8e-04
glioblastoma -1.100 2.5e-04
group 3 medulloblastoma -1.300 9.3e-03
hereditary spastic paraplegia -1.103 4.8e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.9e-02
invasive ductal carcinoma 1.500 5.0e-03
juvenile dermatomyositis 1.132 3.1e-07
lung adenocarcinoma 1.162 6.0e-05
medulloblastoma, large-cell -1.100 2.6e-03
non-small cell lung cancer -1.170 3.6e-08
oligodendroglioma -1.200 2.5e-13
osteosarcoma 1.039 2.0e-02
ovarian cancer 1.600 2.4e-03
Pick disease -1.100 1.5e-02
psoriasis 1.100 3.2e-06
tuberculosis -1.800 8.2e-05

Gene RIF (20)

AA Sequence

MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNTVSNFKRF      1 - 70
HGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDC     71 - 140
VISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAFQV    141 - 210
SACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSN    211 - 280
STDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAV    281 - 350
KERIAKFFGKDISTTLNADEAVARGCALQCAILSPAFKVREFSVTDAVPFPISLIWNHDSEDTEGVHEVF    351 - 420
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIGRFVVQNVSAQKDGEKSRVKVKVRVNTHGIF    421 - 490
TISTASMVEKVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPEL    491 - 560
TSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKE    561 - 630
RNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGT    631 - 700
PVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQA    701 - 770
KKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPH    771 - 840
QNGECYPNEKNSVNMDLD                                                        841 - 858
//

Text Mined References (60)

PMID Year Title