Property Summary

NCBI Gene PubMed Count 121
PubMed Score 1108.98
PubTator Score 739.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Gene RIF (86)

PMID Text
26552664 We were able to identify perlecan as the most likely candidate for the major estrogen-binding protein in the follicular fluid.
26031903 As five of the seven missense mutations in Schwartz-Jampel syndrome affect domain III of perlecan, domain III is likely to be essential for secretion of perlecan into the extracellular space.
25506919 Knockdown of agrin and perlecan promoted a decrease on cell migration and adhesion, and on resistance of cells to cisplatin.
25504735 Rare variants in the HSPG2 gene potentially contribute to the idiopathic scoliosis phenotype in a subset of patients with idiopathic scoliosis
24949484 Mutant genes (CELA1, HSPG2, and KCNK5) in Balkan endemic nephropathy patients encode proteins involved in basement membrane/extracellular matrix and vascular tone, tightly connected to process of angiogenesis.
24833109 We conclude that enzymatic processing of perlecan in the BM or territorial matrix by MMP-7 as occurs in the invasive tumor microenvironment acts as a molecular switch to alter PCa cell behavior and favor cell dispersion and invasiveness.
24562868 The perlecan is the primary ECM molecule comprising intraepithelial stroma of the junctional epithelium, in which leukocytes may migrate on ECM scaffolds in intercellular space toward the surface of the gingival sulci or pockets.
24509440 Perlecan synthesized by smooth muscle cells differs from that synthesized by endothelial cells by possessing different signaling capabilities and thus differential modulation of cell adhesion, proliferation and growth factor signaling.
24365408 this study hypothesizes the transcriptional control of the HSPG2 gene in mast cells to synthesize these transcripts supports their stimulatory and specific role in wound healing and tissue regeneration.
24101524 Data suggest that cancer cell-derived exosomes use heparan sulfate proteoglycans (HSPGs) for their internalization and functional activity, which significantly extends the emerging role of HSPGs as key receptors of macromolecular cargo.
23836919 endorepellin glycoforms may be highly specific and sensitive biomarkers for the differentiation of mucinous from nonmucinous pancreatic cysts.
23599406 Urinary perlecan laminin G-like 3 peptide and Ig kappa light chains were decreased in IgA nephropathy.
23568740 No association has been found between polymorphisms of rs251124 and rs3767137 loci of CSPG2 and HSPG2 genes and intracranial aneurysm in the selected population.
23509972 [review] Perlecan domain V reached the infarcted brain tissue and peri-infarct brain regions because a transient middle cerebral artery occlusion model allowed for vascular reperfusion to the stroked brain region after 1 h of experimental occlusion.
23436656 The overexpression of hypomethylated miR-663 induces chemotherapy resistance in human breast cancer cells by targeting heparin sulfate proteoglycan 2 (HSPG2).
23397188 role for perlecan in chondrogenic and osteogenic events which drive discal development and ossification of the vertebral bodies.
23374253 Endorepellin binds through its proximal LG1/2 domains to VEGFR2 and inhibit VEGFA-dependent endothelial migration.
23336978 Based on genetic analysis of patients with BA and zebrafish, GPC1 appears to be a BA susceptibility gene. These findings also support a role for Hedgehog signaling in the pathogenesis of BA
23235151 This study shows for the first time that mast cells secrete and process the extracellular proteoglycan perlecan into fragments containing the endorepellin C-terminal region that regulate angiogenesis and matrix turnover.
23161552 we suggest that the LG3 fragment of endorepellin could be associated with IgA nephropathy severity and might be related to pathogenesis of IgA nephropathy .
23104139 Report immunolocalization of fibrillin-1/perlecan in human fetal intervertebral disc.
23060442 Endorepellin affects angiogenesis by antagonizing diverse VEGFR2-evoked signaling pathways: transcriptional repression of hypoxia-inducible factor 1alpha and VEGFA and concurrent inhibition of NFAT1 activation.
22643235 The C-terminal fragment of the extracellular matrix component perlecan (domain V, DV) has been shown to be increased in arteriovenous malformation of the brain.
22457785 activity mediated release of LG3/endorepellin into the circulation may represent a biological mechanism for the known inverse association between physical activity and cancer risk/survival
22076637 The perlecan fragment LG3 is a novel regulator of obliterative remodeling associated with allograft vascular rejection.
22003087 TGF-beta(1)-induced perlecan deposition may enhance attachment of migrating airway smooth muscle cells (ASMC) in vivo and thus may be a mechanism for ASMC layer hypertrophy in chronic obstructive pulmonary disease
21808285 association of the HSPG2 intronic SNP, rs2445142, with tardive dyskinesia susceptibility was demonstrated.
21596751 endorepellin requires both the alpha2beta1 integrin and VEGFR2 for its angiostatic activity
21255062 Ameloblastoma cells proliferate and are differentiated by capturing perlecan differentially with alpha-dystroglycan and integrin beta1, respectively
21126803 Domain V of perlecan, a known alpha2 integrin ligand, inhibits brain amyloid-beta neurotoxicity in an alpha2 integrin-dependent manner.
20690028 perlecan followed virtually identical immunolocalisation pattern to type II collagen in foetal joint tissue, but a slightly divergent pattern in adult tissues; evidence indicates perlecan is a marker of chondrogenic cells in prenatal cartilages
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20507176 FGF2 and -18 bind to discrete structures on the heparan sulfate chains attached to chondrocyte-derived perlecan which modulate the growth factor activities
20452482 Observational study of gene-disease association. (HuGE Navigator)
20074558 perlecan plays an indispensible role in endothelial cell proliferation and acts through a mechanism that involves subcellular localization of p27.
20072119 These findings suggest that the HSPG2 gene is involved in neuroleptic-induced tardive dyskinesia (TD) and higher expression of HSPG2, probably even after antipsychotic treatment, and may be associated with TD susceptibility.
20072119 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20053631 in contrast to IA, HSPG2 and CSPG2 do not associate with AAA.
20053631 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19889475 Observational study of gene-disease association. (HuGE Navigator)
19839757 there might be no association between perlecan gene polymorphism and spinal muscular atrophy type I disease.
19839757 Observational study of gene-disease association. (HuGE Navigator)
19789387 Endorepellin caused a widespread reduction in phosphorylation of key receptors involved in angiogenesis & a concurrent increase in phosphatase activity in endothelial cells & tumor xenografts.
19788922 These data highlight the potential role of perlecan oxidation, and consequent deregulation of cell function, in vascular injuries by myeloperoxidase-derived hypochlorous and hypobromous acids.
19669783 The perlecan was prominently immunolocalised in the cartilaginous vertebral body rudiments and to a lesser extent within the foetal intervertebral disc.
19553700 the angioinhibitory action of NK4 involves impaired extracellular assembly of fibronectin mediated by perlecan-NK4 association
19506372 Examine association between perlecan SNPs and intracranial aneurysms in Japanese cohort.
19506372 Observational study of gene-disease association. (HuGE Navigator)
19066875 TT genotype showed significantly increased risk for urolithiasis than TG and GG genotypes.
19066875 Observational study of gene-disease association. (HuGE Navigator)
18658137 Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.
18024432 the angiostatic effects of endorepellin in vivo are mediated by a specific interaction of endorepellin with the alpha2beta1 integrin receptor.
17356275 Observational study of gene-disease association. (HuGE Navigator)
17356275 The HSPG2 BamH I polymorphism C/A of intron 6 may not represent an additional genetic risk factor for late-onset AD.
16984910 perlecan is a prominent pericellular proteoglycan differently expressed in fetal, postnatal, and mature hyaline cartilage
16934308 HSPG interacts strongly with positively charged-V3 loop of X4-tropic gp120, but weakly with less positively charged-V3 loop of R5-tropic gp120 on epithelial cells
16914267 perlecan secreted by VEGF165-stimulated endothelial cells may be involved in the regulation of cellular behavior during angiogenesis
16620836 Reduction of perlecan mRNA-expression and protein deposition in human atherosclerosis, which in part explains the low levels of heparan sulfate in this disease.
16570819 The expression level of perlecan and perlecan mRNA significantly increased in Hep-2 cells as compared with normal cells.
16407285 WARP forms macromolecular structures that interact with perlecan to contribute to the assembly and/or maintenance of "permanent" cartilage structures during development and in mature cartilages
16283481 Perlecan is an essential extracellular matrix component involved in growth responses of metastatic prostate cancer cells to heparin-binding growth factors deposited in local and metastatic microenvironment
16269412 perlecan regulates both the survival and terminal differentiation steps of keratinocytes
16129435 Results describe perlecan purified from HEK-293 cells substituted with heparan sulphate, chondroitin sulphate and keratan sulphate; first to report perlecan containing keratan sulphate
15905187 The gene expression of perlecan is partially suppressed by antiangiogenic forms of antithrombin.
15797855 HSPG interacts strongly with positively charged-V3 loop of X4-tropic gp120, but weakly with less positively charged-V3 loop of R5-tropic gp120 on epithelial cells
15657057 High affinity interactions between fibrillin-1 and perlecan were found by kinetic binding studies with dissociation constants in the low nanomolar range.
15567441 We conclude that the perlecan mediates Tat uptake and is required for HIV-1 LTR-directed transactivation in WiDr cells.
15567441 HSPG interacts strongly with positively charged-V3 loop of X4-tropic gp120, but weakly with less positively charged-V3 loop of R5-tropic gp120 on epithelial cells
15240572 Endorepellin causes endothelial cell disassembly of actin cytoskeleton and focal adhesions through alpha2beta1 integrin
15211644 Observational study of gene-disease association. (HuGE Navigator)
15211644 findings show no evidence for association between HSPG2 intron 6 BamHI polymorphism and Alzheimer's disease in a Jewish population, and no interactive effect was found with the known risk factor apolipoprotein E (APOE) epsilon4.
15081423 Observational study of gene-disease association. (HuGE Navigator)
15031130 Hyperglycemia-induced structural changes in perlecan may result in a subendothelial matrix that is more favorable to retention of monocytes.
14974815 increased expression associated with Cyclosporin A-induced gingival overgrowth
14973356 Observational study of gene-disease association. (HuGE Navigator)
14630925 results demonstrate that extracellular matrix perlecan is a degradative target of heparanase (HPSE-1)
14625044 Observational study of gene-disease association. (HuGE Navigator)
14625044 HSPG2 A allele may possess an additive risk effect in APOE epsilon 4 carriers in a Finnish population with Alzheimer's disease.
14563633 expression of perlecan, but not other HSPGs, is dramatically down-regulated in human umbilical vein endothelial cells (HUVECs) treated with antiangiogenic cleaved and latent forms of antithrombin but not with the native form.
12900424 progranulin/perlecan interactions have a role in the fine regulation of tumor angiogenesis
12811819 CTGF/Hcs24 produced in the hypertrophic region may act on chondrocytes in the proliferative and maturative zone via some heparan sulfate proteoglycan, such as perlecan.
12036876 Identification of integrin alpha(M)beta(2) as an adhesion receptor on human peripheral blood monocytes for Cyr61 and connective tissue growth factor: immediate-early gene products expressed in atherosclerotic lesions.(integrin alpha(M)beta(2))
11968010 Augmented synthesis and differential localization of heparan sulfate proteoglycans in Duchenne muscular dystrophy.
11941538 Structural and functional mutations of the perlecan gene cause Schwartz-Jampel syndrome, with myotonic myopathy and chondrodysplasia

AA Sequence

MGWRAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLG      1 - 70
SGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKEL     71 - 140
DGWVFVELDVGSEGNADGAQIQEMLLRVISSGSVASYVTSPQGFQFRRLGTVPQFPRACTEAEFACHSYN    141 - 210
ECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVETTSLPPRPETTIMRQPPVTHAPQPLLPGSV    211 - 280
RPLPCGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDC    281 - 350
EDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASR    351 - 420
GQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCEAMNARGMVFG    421 - 490
IPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQ    491 - 560
PGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPV    561 - 630
QRPDVVLMGAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESGRPVQRAELLQVLQSLEAVLIQTVYNT    631 - 700
KMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHA    701 - 770
SSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCD    771 - 840
ACAPGYTGRRCESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGRLCNECADGS    841 - 910
FHLSTRNPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFSS    911 - 980
FHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQGNNIILEHHVAQEPSPG    981 - 1050
QPSTFIVPFREQAWQRPDGQPATREHLLMALAGIDTLLIRASYAQQPAESRVSGISMDVAVPEETGQDPA   1051 - 1120
LEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQC   1121 - 1190
QPGYYGDAQRGTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQG   1191 - 1260
QPCQRDSQVPGPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCMGI   1261 - 1330
TQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAQLGHESFYWQLP   1331 - 1400
ETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPALQGPERRSYEIMFREEFWRR   1401 - 1470
PDGQPATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLS   1471 - 1540
CQDCAPGYTRTGSGLYLGHCELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDC   1541 - 1610
QPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGQCLPETNQAPLVVE   1611 - 1680
VHPARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSDAGVYICTCRN   1681 - 1750
LHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPTRAMD   1751 - 1820
FNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQASGTLSAPVVSIHPPQLTVQPGQLAEFRCSAT   1821 - 1890
GSPTPTLEWTGGPGGQLPAKAQIHGGILRLPAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQV   1891 - 1960
SPERTQVHAGRTVRLYCRAAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSP   1961 - 2030
AGTAQARIQVVVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGS   2031 - 2100
RLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTRPIRIEPSSSHVAEGQTLD   2101 - 2170
LNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSGEYVCHVVGTSGPLEASVLVTIEASVI   2171 - 2240
PGPIPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGQYV   2241 - 2310
CRASNGMEASITVTVTGTQGANLAYPAGSTQPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGS   2311 - 2380
LPVRHQTHGSLLRLYQASPADSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSQVAE   2381 - 2450
GQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTI   2451 - 2520
QQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQV   2521 - 2590
TPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPTVVEGQTLDLNCVVARQPQAI   2591 - 2660
ITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANNNIDALEASIVISVSPSAGSPSAPGSSMPIR   2661 - 2730
IESSSSHVAEGETLDLNCVVPGQAHAQVTWHKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRVMGSSG   2731 - 2800
PLEASVLVTIEASGSSAVHVPAPGGAPPIRIEPSSSRVAEGQTLDLKCVVPGQAHAQVTWHKRGGNLPAR   2801 - 2870
HQVHGPLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQ   2871 - 2940
TLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHLVSPADSGEYVCRAASGPGPEQEASFTVTVP   2941 - 3010
PSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVG   3011 - 3080
TRPSNHGTYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRIS   3081 - 3150
STPAKLEQRTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQAEEAE   3151 - 3220
LTVEAGHTATLRCSATGSPAPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEAT   3221 - 3290
IILHVESPPYATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDS   3291 - 3360
GRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQ   3361 - 3430
LRWFKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTV   3431 - 3500
VVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAGTTQSHVLL   3501 - 3570
LVQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDSRLENNMLMLPSVRPQDAGTYV   3571 - 3640
CTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKRVP   3641 - 3710
GSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVN   3711 - 3780
GTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRD   3781 - 3850
RPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGLR   3851 - 3920
CEEGVTVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAMVGGHLE   3921 - 3990
FRYELGSGLAVLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPS   3991 - 4060
VPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQHGATCMPAGEYEFQCL   4061 - 4130
CRDGFKGDLCEHEENPCQLREPCLHGGTCQGTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPG   4131 - 4200
QYGAYFHDDGFLAFPGHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFISLGLQDGHLV   4201 - 4270
FRYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSPGPNVAVNAKGSVYIGGAPDV   4271 - 4340
ATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS                      4341 - 4391
//

Text Mined References (128)

PMID Year Title
26552664 2016 What maintains the high intra-follicular estradiol concentration in pre-ovulatory follicles?
26031903 2015 A missense mutation in domain III in HSPG2 in Schwartz-Jampel syndrome compromises secretion of perlecan into the extracellular space.
25506919 2014 Agrin and perlecan mediate tumorigenic processes in oral squamous cell carcinoma.
25504735 2014 Exome sequencing identifies a rare HSPG2 variant associated with familial idiopathic scoliosis.
24949484 2014 NGS nominated CELA1, HSPG2, and KCNK5 as candidate genes for predisposition to Balkan endemic nephropathy.
24833109 2014 Matrilysin/matrix metalloproteinase-7(MMP7) cleavage of perlecan/HSPG2 creates a molecular switch to alter prostate cancer cell behavior.
24700612 2014 Transcriptional activation by NF?B increases perlecan/HSPG2 expression in the desmoplastic prostate tumor microenvironment.
24562868 2014 Perlecan-enriched intercellular space of junctional epithelium provides primary infrastructure for leukocyte migration through squamous epithelial cells.
24509440 2014 The role of vascular-derived perlecan in modulating cell adhesion, proliferation and growth factor signaling.
24486410 2014 Heparan sulfate proteoglycans and heparin regulate melanoma cell functions.
24365408 2014 Transcriptional complexity of the HSPG2 gene in the human mast cell line, HMC-1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24101524 2013 Cancer cell exosomes depend on cell-surface heparan sulfate proteoglycans for their internalization and functional activity.
24001398 2014 Border patrol: insights into the unique role of perlecan/heparan sulfate proteoglycan 2 at cell and tissue borders.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23836919 2013 Specific glycoforms of MUC5AC and endorepellin accurately distinguish mucinous from nonmucinous pancreatic cysts.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23599406 2013 Association of urinary laminin G-like 3 and free K light chains with disease activity and histological injury in IgA nephropathy.
23568740 2013 [Association of single nucleotide polymorphisms of CSPG2 and HSPG2 genes with intracranial aneurysm in ethnic Han Chinese population].
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23509972 2013 Perlecan domain V therapy for stroke: a beacon of hope?
23436656 2013 The overexpression of hypomethylated miR-663 induces chemotherapy resistance in human breast cancer cells by targeting heparin sulfate proteoglycan 2 (HSPG2).
23397188 2013 Comparative immunolocalisation of perlecan, heparan sulphate, fibroblast growth factor-18, and fibroblast growth factor receptor-3 and their prospective roles in chondrogenic and osteogenic development of the human foetal spine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23374253 2013 Endorepellin laminin-like globular 1/2 domains bind Ig3-5 of vascular endothelial growth factor (VEGF) receptor 2 and block pro-angiogenic signaling by VEGFA in endothelial cells.
23336978 2013 Evidence from human and zebrafish that GPC1 is a biliary atresia susceptibility gene.
23235151 2013 Mast cells produce novel shorter forms of perlecan that contain functional endorepellin: a role in angiogenesis and wound healing.
23161552 2013 LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy.
23104139 2013 Comparative immunolocalisation of fibrillin-1 and perlecan in the human foetal, and HS-deficient hspg2 exon 3 null mutant mouse intervertebral disc.
23060442 2012 Endorepellin affects angiogenesis by antagonizing diverse vascular endothelial growth factor receptor 2 (VEGFR2)-evoked signaling pathways: transcriptional repression of hypoxia-inducible factor 1? and VEGFA and concurrent inhibition of nuclear factor of activated T cell 1 (NFAT1) activation.
22643235 2012 Perlecan domain V is upregulated in human brain arteriovenous malformation and could mediate the vascular endothelial growth factor effect in lesional tissue.
22457785 2012 A fragment of the LG3 peptide of endorepellin is present in the urine of physically active mining workers: a potential marker of physical activity.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22076637 2012 The perlecan fragment LG3 is a novel regulator of obliterative remodeling associated with allograft vascular rejection.
22003087 2012 TGF-? enhances deposition of perlecan from COPD airway smooth muscle.
21996443 2011 Crystal structure of the LG3 domain of endorepellin, an angiogenesis inhibitor.
21808285 2012 Support for association of HSPG2 with tardive dyskinesia in Caucasian populations.
21596751 2011 Endorepellin, the angiostatic module of perlecan, interacts with both the ?2?1 integrin and vascular endothelial growth factor receptor 2 (VEGFR2): a dual receptor antagonism.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21255062 2011 Differential expression profiles between ?-dystroglycan and integrin ?1 in ameloblastoma: two possible perlecan signalling pathways for cellular growth and differentiation.
21126803 2012 Perlecan domain V inhibits ?2 integrin-mediated amyloid-? neurotoxicity.
20690028 2010 Comparative immunolocalisation of perlecan with collagen II and aggrecan in human foetal, newborn and adult ovine joint tissues demonstrates perlecan as an early developmental chondrogenic marker.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20507176 2010 Heparan sulfate-dependent signaling of fibroblast growth factor 18 by chondrocyte-derived perlecan.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20074558 2010 p27 Nuclear localization and growth arrest caused by perlecan knockdown in human endothelial cells.
20072119 2010 Association of the HSPG2 gene with neuroleptic-induced tardive dyskinesia.
20053631 2010 The intracranial aneurysm susceptibility genes HSPG2 and CSPG2 are not associated with abdominal aortic aneurysm.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19889475 2011 No replication of genetic association between candidate polymorphisms and Alzheimer's disease.
19839757 2009 Preliminary results in a study regarding the relationship between perlecan gene polymorphism and spinal muscular atrophy type I disease.
19789387 2009 Role of tyrosine phosphatase SHP-1 in the mechanism of endorepellin angiostatic activity.
19788922 2010 Myeloperoxidase-derived oxidants selectively disrupt the protein core of the heparan sulfate proteoglycan perlecan.
19669783 2009 Topographical variation in the distributions of versican, aggrecan and perlecan in the foetal human spine reflects their diverse functional roles in spinal development.
19553700 2009 Angioinhibitory action of NK4 involves impaired extracellular assembly of fibronectin mediated by perlecan-NK4 association.
19506372 2009 Association analysis of genes involved in the maintenance of the integrity of the extracellular matrix with intracranial aneurysms in a Japanese cohort.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19066875 2009 Heparan sulfate gene polymorphism in calcium oxalate nephrolithiasis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18658137 2008 Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.
18024432 2008 Integrin alpha2beta1 is the required receptor for endorepellin angiostatic activity.
17356275 2007 HSPG2 gene C/A polymorphism does not confer susceptibility to Alzheimer's disease in Chinese.
17105986 2006 Endorepellin in vivo: targeting the tumor vasculature and retarding cancer growth and metabolism.
16984910 2006 The structure, location, and function of perlecan, a prominent pericellular proteoglycan of fetal, postnatal, and mature hyaline cartilages.
16927315 2006 Spectrum of HSPG2 (Perlecan) mutations in patients with Schwartz-Jampel syndrome.
16914267 2006 The vascular endothelial growth factor VEGF165 induces perlecan synthesis via VEGF receptor-2 in cultured human brain microvascular endothelial cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16620836 2007 Reduced perlecan expression and accumulation in human carotid atherosclerotic lesions.
16570819 2006 [Expression of perlecan in laryngeal carcinoma cell and its significance].
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16407285 2006 WARP is a novel multimeric component of the chondrocyte pericellular matrix that interacts with perlecan.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16283481 2005 Perlecan knockdown in metastatic prostate cancer cells reduces heparin-binding growth factor responses in vitro and tumor growth in vivo.
16269412 2006 Targeting perlecan in human keratinocytes reveals novel roles for perlecan in epidermal formation.
16129435 2005 Perlecan from human epithelial cells is a hybrid heparan/chondroitin/keratan sulfate proteoglycan.
15905187 2005 The heparin-binding site of antithrombin is crucial for antiangiogenic activity.
15657057 2005 Microfibrils at basement membrane zones interact with perlecan via fibrillin-1.
15591058 2005 BMP-1/Tolloid-like metalloproteases process endorepellin, the angiostatic C-terminal fragment of perlecan.
15567441 2004 The perlecan heparan sulfate proteoglycan mediates cellular uptake of HIV-1 Tat through a pathway responsible for biological activity.
15240572 2004 Endorepellin causes endothelial cell disassembly of actin cytoskeleton and focal adhesions through alpha2beta1 integrin.
15211644 2004 An association study of a polymorphism in the heparan sulfate proteoglycan gene (perlecan, HSPG2) and Alzheimer's disease.
15081423 2004 Single nucleotide polymorphisms associated with aggressive periodontitis and severe chronic periodontitis in Japanese.
15031130 2004 High glucose-induced alterations in subendothelial matrix perlecan leads to increased monocyte binding.
14974815 2003 Gene expression of extracellular matrix proteoglycans in human cyclosporin-induced gingival overgrowth.
14973356 2004 Lack of association between perlecan gene intron 6 BamHI polymorphism and risk of mitral valve prolapse in Taiwan Chinese.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630925 2004 Heparanase degrades syndecan-1 and perlecan heparan sulfate: functional implications for tumor cell invasion.
14625044 2003 Heparan sulfate proteoglycan 2 polymorphism in Alzheimer's disease and correlation with neuropathology.
14563633 2004 Antiangiogenic antithrombin down-regulates the expression of the proangiogenic heparan sulfate proteoglycan, perlecan, in endothelial cells.
12900424 2003 A novel interaction between perlecan protein core and progranulin: potential effects on tumor growth.
12811819 2003 CTGF/Hcs24, hypertrophic chondrocyte-specific gene product, interacts with perlecan in regulating the proliferation and differentiation of chondrocytes.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12604605 2003 Perlecan protein core interacts with extracellular matrix protein 1 (ECM1), a glycoprotein involved in bone formation and angiogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435733 2003 Endorepellin, a novel inhibitor of angiogenesis derived from the C terminus of perlecan.
12036876 2002 Identification of integrin alpha(M)beta(2) as an adhesion receptor on peripheral blood monocytes for Cyr61 (CCN1) and connective tissue growth factor (CCN2): immediate-early gene products expressed in atherosclerotic lesions.
11968010 2002 Augmented synthesis and differential localization of heparan sulfate proteoglycans in Duchenne muscular dystrophy.
11956183 2002 The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin.
11847221 2002 Not all perlecans are created equal: interactions with fibroblast growth factor (FGF) 2 and FGF receptors.
11847210 2002 The leucine-rich repeat protein PRELP binds perlecan and collagens and may function as a basement membrane anchor.
11493006 2001 Mapping of binding sites for nidogens, fibulin-2, fibronectin and heparin to different IG modules of perlecan.
11279527 2001 Dyssegmental dysplasia, Silverman-Handmaker type, is caused by functional null mutations of the perlecan gene.
11148217 2001 Fibroblast growth factor-binding protein is a novel partner for perlecan protein core.
11101850 2000 Perlecan, the major proteoglycan of basement membranes, is altered in patients with Schwartz-Jampel syndrome (chondrodystrophic myotonia).
10702276 2000 The protein core of the proteoglycan perlecan binds specifically to fibroblast growth factor-7.
10579711 1999 Life without perlecan has its problems.
10545953 1999 Perlecan is essential for cartilage and cephalic development.
9733643 1998 Nidogen-2: a new basement membrane protein with diverse binding properties.
9692901 1998 Mapping of the binding of platelet-derived growth factor to distinct domains of the basement membrane proteins BM-40 and perlecan and distinction from the BM-40 collagen-binding epitope.
9688542 1998 The N-terminal globular domain of the laminin alpha1 chain binds to alpha1beta1 and alpha2beta1 integrins and to the heparan sulfate-containing domains of perlecan.
9431988 1997 The C-terminal domain V of perlecan promotes beta1 integrin-mediated cell adhesion, binds heparin, nidogen and fibulin-2 and can be modified by glycosaminoglycans.
9313766 1997 Genetic variation of the heparan sulfate proteoglycan gene (perlecan gene). Association with urinary albumin excretion in IDDM patients.
9307034 1997 Binding of perlecan to transthyretin in vitro.
9136074 1997 Interaction between Alzheimer's disease beta A4 precursor protein (APP) and the extracellular matrix: evidence for the participation of heparan sulfate proteoglycans.
8541852 1995 Localization of the Schwartz-Jampel syndrome (SJS) locus to chromosome 1p34-p36.1 by homozygosity mapping.
8234307 1993 Structural characterization of the complete human perlecan gene and its promoter.
7500359 1995 Binding of mouse and human fibulin-2 to extracellular matrix ligands.
2745554 1989 SPARC, a secreted protein associated with cellular proliferation, inhibits cell spreading in vitro and exhibits Ca+2-dependent binding to the extracellular matrix.
2687294 1989 Matrix-associated heparan sulfate proteoglycan: core protein-specific monoclonal antibodies decorate the pericellular matrix of connective tissue cells and the stromal side of basement membranes.
1730768 1992 Human basement membrane heparan sulfate proteoglycan core protein: a 467-kD protein containing multiple domains resembling elements of the low density lipoprotein receptor, laminin, neural cell adhesion molecules, and epidermal growth factor.
1685141 1991 Cloning of human heparan sulfate proteoglycan core protein, assignment of the gene (HSPG2) to 1p36.1----p35 and identification of a BamHI restriction fragment length polymorphism.
1679749 1991 Heparan sulfate proteoglycan of human colon: partial molecular cloning, cellular expression, and mapping of the gene (HSPG2) to the short arm of human chromosome 1.
1569102 1992 Primary structure of the human heparan sulfate proteoglycan from basement membrane (HSPG2/perlecan). A chimeric molecule with multiple domains homologous to the low density lipoprotein receptor, laminin, neural cell adhesion molecules, and epidermal growth factor.