Property Summary

NCBI Gene PubMed Count 6
PubMed Score 31.63
PubTator Score 13.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.232 1.0e-05
astrocytoma 1.300 6.9e-03
dermatomyositis 1.200 3.6e-03
group 3 medulloblastoma 1.300 3.9e-03
malignant mesothelioma 1.200 9.5e-06
osteosarcoma -1.849 2.6e-06
ovarian cancer 1.700 1.1e-06
subependymal giant cell astrocytoma 1.529 2.2e-02

Gene RIF (3)

AA Sequence

MAAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVFDWPARHWNAKYLSQVLHGK      1 - 70
QIRFRMGMKSMSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYKYFVSLFEDKT     71 - 140
DLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTRIP    141 - 210
YEESSVFSKINVVNPDLKRFPQFRKAQRHAVTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIELEEDHL    211 - 280
ARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTD    281 - 350
GEHMKKEELNVCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDK    351 - 420
DGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFISTDDLLDCLVNPQVTRIVAQLLIQGRSL      421 - 488
//

Text Mined References (9)

PMID Year Title