Property Summary

NCBI Gene PubMed Count 67
PubMed Score 99.48
PubTator Score 94.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma 1.600 2.3e-07
Barrett's esophagus -1.300 2.7e-02
esophageal adenocarcinoma -2.300 2.2e-02
oligodendroglioma -1.600 5.1e-06
glioblastoma -2.000 9.6e-03
group 4 medulloblastoma -3.400 1.7e-05
cystic fibrosis -1.270 4.4e-05
type II diabetes mellitus and post-ische... 1.500 1.9e-02
atypical teratoid/rhabdoid tumor -2.300 3.1e-05
medulloblastoma, large-cell -3.100 4.0e-04
tuberculosis and treatment for 3 months -1.200 3.6e-04
intraductal papillary-mucinous carcinoma... 2.200 1.5e-02
colon cancer -2.800 1.0e-05
lung cancer -1.400 1.3e-04
fibroadenoma 1.300 5.8e-03
interstitial cystitis 1.200 1.7e-02
pediatric high grade glioma -2.300 5.7e-04
posterior fossa group B ependymoma 1.600 4.3e-07
subependymal giant cell astrocytoma -1.500 2.0e-02
ductal carcinoma in situ 1.200 4.4e-02
ovarian cancer -3.000 3.7e-07
pituitary cancer -2.100 6.7e-04
Down syndrome 1.700 1.9e-03
chronic rhinosinusitis -1.170 2.7e-02
head and neck cancer -1.500 5.5e-03
psoriasis -1.100 3.4e-44

Gene RIF (49)

PMID Text
26676989 ACE and PDIA6 were identified as potential HSPA2-interacting proteins; this assemblage resides in membrane raft microdomains located in the peri-acrosomal region of the sperm head.
26164067 HSPA2 expression increased under conditions that stimulated HIF-1alpha activity, whereas inhibition of HIF-1alpha abrogated hypoxia-induced up-regulation of HSPA2 expression
25890028 Results suggest that overexpression of HSPA2 in pancreatic cancer is associated with aggressive progression and poor prognosis and that HSPA2 may be served as a prognostic marker.
25865850 we consider the evidence supporting the role of HSPA2 in sperm function and explore the potential mechanisms by which it is depleted in the spermatozoa of infertile patients--{REVIEW}
25308252 The fertilization rate with ICSI is associated with HspA2 expression in the testis from which sperm retrieved and the alteration of HspA2 expression has been involved in spermatogenic impairment.
25117073 High expression of HSPA2 is associated with hepatocellular carcinoma.
25108126 HSP70-2 +1267 polymorphism may influence the risk of coronary artery disease (CAD) in Iranian population, however further studies are needed to clarify the role of other HSP70-2 gene polymorphisms in the pathogenesis of the CAD.
24922646 High HSPA2 expression is associated with non-small cell lung carcinoma.
24485944 Genotype analysis of HSP70-2 (+1267 A/G) polymorphism revealed a significant association between the minor allele G and presence of Multiple Sclerosis
24051039 findings show polymorphisms of HSP70 genes are associated with the development of gastric cancer and duodenal ulcers in a population at high risk for gastric cancer in Costa Rica
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages
23777267 Overexpression of HSPA2 is correlated with esophageal squamous cell carcinoma.
23425104 Its single nucleotide polymorphism is associated with severityof Crohn's disease.
23247813 HSPA2 regulates the expression of sperm surface receptors involved in human sperm-oocyte recognition, such as arylsulfatase A and SPAM1.
23209833 The interaction between SPAM1, ARSA and HSPA2 in a multimeric complex mediating sperm-egg interaction.
22670834 Heat-shock protein A2(HSPA2) expression significantly correlates with sperm concentration and morphology thus aberrant HSPA2 expression may play an important role in capacitation and fertilisation processes
22397456 In somatic cells HSPA2 can be a part of a system protecting cells against cytotoxic stimuli inducing proteotoxic stress.
22353510 It appears that polymorphism of HSP70-2 gene is not directly associated with the susceptibility to peptic ulcer diseases but BB genotype is associated with an increased risk of duodenal ulcer in older subjects in the Japanese population.
21763498 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages
21738476 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages
21373891 The results clearly show that certain human tissues constitutively express varying levels of HSPA2 protein in a highly differentiated way.
20975101 GDF15, HSPA2, TMEFF2, and VIM were identified as epigenetic biomarkers for Bladder cancer.
19661373 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19275587 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages
19167759 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18813331 Observational study of gene-disease association. (HuGE Navigator)
18452162 The HspA2, like Hsp70 protein, can be involved in protecting nucleoli and centrosomes integrity in cancer cells subjected to heat shock and, possibly, other cellular stressors.
17940904 Observational study of gene-disease association. (HuGE Navigator)
17922431 results indicate that the there may be no association of the HSP70-2 gene polymorphism with ankylosing spondylitis in Chinese Han population
17922431 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17532782 Observational study of gene-disease association. (HuGE Navigator)
17369882 Delineation of the minimal promoter is a basic step toward identifying the cis and trans elements involved in the regulation of the HSPA2 gene expression, especially in cancer cells.
17009596 Observational study of gene-disease association. (HuGE Navigator)
17007855 This is the first report on HSPA2 gene expression in ejaculated spermatozoa from adolescents and its relationship with varicocele pathology.
16875346 Observational study of gene-disease association. (HuGE Navigator)
16517558 The HspA2 gene was down-regulated in sperm from infertile men with idiopathic oligoteratozoospermia, suggesting that such anomalies of gene expression might be associated with pathogenesis in some subtypes of male infertility.
12832005 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages
12782964 Observational study of gene-disease association. (HuGE Navigator)
12771604 Observational study of gene-disease association. (HuGE Navigator)
12730033 Observational study of gene-disease association. (HuGE Navigator)
11932435 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages
11334675 Observational study of gene-disease association. (HuGE Navigator)
11196683 Observational study of gene-disease association. (HuGE Navigator)
11040178 Observational study of gene-disease association. (HuGE Navigator)
10964507 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages
10617616 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages
7906708 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of heat shock 70kDa protein 2 (HSPA2, HSP70-2) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFD      1 - 70
AKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKV     71 - 140
HSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDV    141 - 210
SILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSS    211 - 280
TQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQ    281 - 350
KLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN    351 - 420
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILN    421 - 490
VTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEK    491 - 560
LRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGAS    561 - 630
GGPTIEEVD                                                                 631 - 639
//

Text Mined References (70)

PMID Year Title
26676989 2016 Heat Shock Protein member A2 forms a stable complex with angiotensin converting enzyme and protein disulfide isomerase A6 in human spermatozoa.
26164067 2015 Cell type-dependent modulation of the gene encoding heat shock protein HSPA2 by hypoxia-inducible factor HIF-1: Down-regulation in keratinocytes and up-regulation in HeLa cells.
25890028 2015 Expression and clinical significance of HSPA2 in pancreatic ductal adenocarcinoma.
25865850 The role of the molecular chaperone heat shock protein A2 (HSPA2) in regulating human sperm-egg recognition.
25416956 2014 A proteome-scale map of the human interactome network.
25308252 2014 Depression of HspA2 in human testis is associated with spermatogenic impairment and fertilization rate in ICSI treatment for azoospermic individuals.
25117073 2014 Expression of HSPA2 in human hepatocellular carcinoma and its clinical significance.
25108126 2014 Association of heat shock protein70-2 (HSP70-2) gene polymorphism with coronary artery disease in an Iranian population.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24922646 2014 HSPA2 is expressed in human tumors and correlates with clinical features in non-small cell lung carcinoma patients.
24485944 2014 Are Hsp70 protein expression and genetic polymorphism implicated in multiple sclerosis inflammation?
24051039 2013 Polymorphisms in genes coding for HSP-70 are associated with gastric cancer and duodenal ulcer in a population at high risk of gastric cancer in Costa Rica.
23921388 2013 Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation.
23777267 2013 Overexpression of HSPA2 is correlated with poor prognosis in esophageal squamous cell carcinoma.
23425104 2013 Crohn's disease and polymorphism of heat shock protein gene HSP70-2 in the Chinese population.
23247813 2013 Investigation of the mechanisms by which the molecular chaperone HSPA2 regulates the expression of sperm surface receptors involved in human sperm-oocyte recognition.
23209833 2012 The molecular chaperone HSPA2 plays a key role in regulating the expression of sperm surface receptors that mediate sperm-egg recognition.
22670834 2013 Evaluation of HSPA2 in fertile and infertile individuals.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22397456 2012 HSPA2 overexpression protects V79 fibroblasts against bortezomib-induced apoptosis.
22353510 Role of heat-shock protein (HSP) 70-2 genotype in peptic ulcer in Japanese population.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21373891 2011 Differential expression of HSPA1 and HSPA2 proteins in human tissues; tissue microarray-based immunohistochemical study.
21269460 2011 Initial characterization of the human central proteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20975101 2010 Three epigenetic biomarkers, GDF15, TMEFF2, and VIM, accurately predict bladder cancer from DNA-based analyses of urine samples.
20072699 2010 Crystal structures of the ATPase domains of four human Hsp70 isoforms: HSPA1L/Hsp70-hom, HSPA2/Hsp70-2, HSPA6/Hsp70B', and HSPA5/BiP/GRP78.
19946888 2010 Defining the membrane proteome of NK cells.
19661373 2009 The BB genotype of heat-shock protein (HSP) 70-2 gene is associated with gastric pre-malignant condition in H. pylori-infected older patients.
19167759 2009 HLA-association of serum levels of natural antibodies.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18813331 2009 Variations in HSP70 genes associated with noise-induced hearing loss in two independent populations.
18529014 2008 FKBP36 forms complexes with clathrin and Hsp72 in spermatocytes.
18452162 2008 The HspA2 protein localizes in nucleoli and centrosomes of heat shocked cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17940904 2008 Polymorphisms of the MCP-1 and HSP70-2 genes in Korean patients with alcoholic chronic pancreatitis.
17922431 2007 [The heat shock protein 70-2 gene +1267(A/G) polymorphism and susceptibility to ankylosing spondylitis in Chinese Han population].
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17532782 2007 Heat shock protein gene 70-2 polymorphism is differentially associated with the clinical phenotypes of ulcerative colitis and Crohn's disease.
17369882 2007 The structural and functional analysis of the human HSPA2 gene promoter region.
17009596 2006 Association of hsp70 polymorphisms with risk of noise-induced hearing loss in Chinese automobile workers.
17007855 2006 Expression of the HSPA2 gene in ejaculated spermatozoa from adolescents with and without varicocele.
16875346 [Influence of alleles and haplotypes of the main histocompatibility complex on the susceptibility to systemic lupus erythematosus in the Mexican population].
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16517558 2006 Oligozoospermia and heat-shock protein expression in ejaculated spermatozoa.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782964 2003 Joint analysis of candidate genes related to Alzheimer's disease in a Spanish population.
12771604 2003 Heat shock protein 70-2+1267 AA homozygotes have an increased risk of septic shock in adults with community-acquired pneumonia.
12730033 2003 Heat-shock protein HSP70-2 genotypes in patients with Crohn's disease: a more severe clinical course with intestinal complications in presence of the PstI-polymorphism.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11932435 2002 Specific incorporation of heat shock protein 70 family members into primate lentiviral virions.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11334675 2001 Association analysis of HLA-class II and class III gene polymorphisms in the susceptibility to mediterranean visceral leishmaniasis.
11196683 2000 Lack of association between the polymorphism at the heat-shock protein (HSP70-2) gene and systemic lupus erythematosus (SLE) in the Mexican mestizo population.
11040178 2000 Genetic factors determine extent of bone loss in inflammatory bowel disease.
10964507 2000 Heat-shock protein 70 can replace viral protein R of HIV-1 during nuclear import of the viral preintegration complex.
10617616 2000 Requirement for a kinase-specific chaperone pathway in the production of a Cdk9/cyclin T1 heterodimer responsible for P-TEFb-mediated tat stimulation of HIV-1 transcription.
9247342 1997 HSP70-2 is required for CDC2 kinase activity in meiosis I of mouse spermatocytes.
8622925 1996 Targeted gene disruption of Hsp70-2 results in failed meiosis, germ cell apoptosis, and male infertility.
8601336 1996 HSP70-2 is part of the synaptonemal complex in mouse and hamster spermatocytes.
7849706 1994 A heat shock gene at 14q22: mapping and expression.
7829106 1994 Cloning, sequencing, and mapping of the human chromosome 14 heat shock protein gene (HSPA2).
3037489 1987 Structure and expression of a human gene coding for a 71 kd heat shock 'cognate' protein.
1474216 1992 Amino acid limitation and flow to the duodenum at four stages of lactation. 2. Extent of lysine limitation.