Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.04
PubTator Score 4.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma -1.700 1.8e-05
ductal carcinoma in situ -1.200 5.3e-03
fibroadenoma -1.500 4.0e-03
invasive ductal carcinoma -1.800 1.4e-04
lung adenocarcinoma -3.100 1.2e-24
non-small cell lung cancer -2.048 1.3e-22
osteosarcoma -1.319 2.5e-02

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (14)

AA Sequence

MLAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTT      1 - 70
SSGYAFSFASDPEAIHMMRKWEGGDPGVAHQKTPTCLLLTPEGAFHSFGYTARDYYHDLDPEEARDWLYF     71 - 140
EKFKMKIHSATDLTLKTQLEAVNGKTMPALEVFAHALRFFREHALQELREQSPSLPEKDTVRWVLTVPAI    141 - 210
WKQPAKQFMREAAYLAGLVSRENAEQLLIALEPEAASVYCRKLRLHQLLDLSGRAPGGGRLGERRSIDSS    211 - 280
FRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVADCGGGTVDLTVHQLEQPHGTLKELYKASGGP    281 - 350
YGAVGVDLAFEQLLCRIFGEDFIATFKRQRPAAWVDLTIAFEARKRTAGPHRAGALNISLPFSFIDFYRK    351 - 420
QRGHNVETALRRSSVNFVKWSSQGMLRMSCEAMNELFQPTVSGIIQHIEALLARPEVQGVKLLFLVGGFA    421 - 490
ESAVLQHAVQAALGARGLRVVVPHDVGLTILKGAVLFGQAPGVVRVRRSPLTYGVGVLNRFVPGRHPPEK    491 - 560
LLVRDGRRWCTDVFERFVAAEQSVALGEEVRRSYCPARPGQRRVLINLYCCAAEDARFITDPGVRKCGAL    561 - 630
SLELEPADCGQDTAGAPPGRREIRAAMQFGDTEIKVTAVDVSTNRSVRASIDFLSN                  631 - 686
//

Text Mined References (20)

PMID Year Title