Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 5.51
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.7e-03
malignant mesothelioma 1.900 3.8e-07
medulloblastoma, large-cell -1.100 1.8e-03
subependymal giant cell astrocytoma 2.312 2.6e-02

 GWAS Trait (1)

PDB (10)

Gene RIF (2)

AA Sequence

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK      1 - 70
TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS     71 - 140
SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM    141 - 210
LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS              211 - 270
//

Text Mined References (15)

PMID Year Title