Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.23
PubTator Score 37.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 7.1e-70
lung adenocarcinoma 2714 8.8e-12
lung carcinoma 2844 1.7e-06

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.400 8.8e-12
lung carcinoma -1.500 1.7e-06
psoriasis -2.900 7.1e-70

Synonym

Accession Q7Z5P4 A8K9R9 Q2M1L5 Q86W22 Q86W23 17-beta-HSD 13
Symbols SCDR9
NIIL497
SDR16C3
HMFN0376

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
25028495 17beta-HSD13 as a pathogenic protein in the development of nonalcoholic fatty liver disease.
17311113 A new human short-chain dehydrogenase/reductase gene SCDR9 is cloned and expressed.

AA Sequence

MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK      1 - 70
RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT     71 - 140
FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG    141 - 210
IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI    211 - 280
LNRMQNIQFEAVVGHKIKMK                                                      281 - 300
//

Text Mined References (12)

PMID Year Title
25028495 2014 Comparative proteomic study reveals 17?-HSD13 as a pathogenic protein in nonalcoholic fatty liver disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23568457 2013 Genetic variants associated with disordered eating.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17311113 2007 Molecular cloning and expression analysis of a new gene for short-chain dehydrogenase/reductase 9.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.