Property Summary

NCBI Gene PubMed Count 15
PubMed Score 23.62
PubTator Score 14.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.800 1.2e-03
atypical teratoid / rhabdoid tumor -1.100 2.0e-07
chronic lymphosyte leukemia 1.200 1.1e-03
colon cancer 1.800 2.6e-02
ependymoma -1.500 9.0e-03
group 4 medulloblastoma -2.500 4.1e-03
interstitial cystitis -1.300 3.6e-03
lung cancer 1.300 4.2e-03
medulloblastoma, large-cell -1.200 3.3e-04
non-small cell lung cancer 1.236 2.3e-06
ovarian cancer -2.300 1.2e-07
pancreatic cancer 2.800 4.2e-07
pituitary cancer -3.600 7.8e-13
primitive neuroectodermal tumor -1.900 1.8e-02
tuberculosis -2.200 1.0e-07
ulcerative colitis 2.400 3.0e-06

Gene RIF (2)

AA Sequence

MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRAL      1 - 70
LEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSI     71 - 140
RLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLR    141 - 210
HIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPK    211 - 280
LLNKLHEYFHEPNKKFFELVGRTFDWH                                               281 - 307
//

Text Mined References (15)

PMID Year Title