Property Summary

Ligand Count 2,279
NCBI Gene PubMed Count 49
PubMed Score 570.24
PubTator Score 334.43

Knowledge Summary

Patent (25,069)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 6.0e-03
astrocytoma -1.200 6.5e-16
Astrocytoma, Pilocytic -1.900 1.4e-05
atypical teratoid / rhabdoid tumor -1.300 1.5e-05
ependymoma -1.200 1.7e-02
glioblastoma -1.600 1.0e-05
group 3 medulloblastoma -2.400 2.5e-03
osteosarcoma 1.374 7.7e-06
ovarian cancer 1.100 9.7e-11
pituitary cancer 1.100 1.1e-05
psoriasis 4.000 2.4e-89

Gene RIF (38)

AA Sequence

MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFVADSSLRTQNN      1 - 70
FFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTSSAFNIVLISYDRFLSVTRAV     71 - 140
SYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGGSSIPEGHCYAEFFYNWYFLITASTLEFFTP    141 - 210
FLSVTFFNLSIYLNIQRRTRLRLDGAREAAGPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEA    211 - 280
AVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRL    281 - 350
SRDRKVAKSLAVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR    351 - 420
RAFTKLLCPQKLKIQPHSSLEHCWK                                                 421 - 445
//

Text Mined References (50)

PMID Year Title