Property Summary

Ligand Count 47
NCBI Gene PubMed Count 68
PubMed Score 1595.15
PubTator Score 82.90

Knowledge Summary

Patent (10,472)

TINX Plot

  Disease (7)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.300 7.4e-187

Gene RIF (53)

AA Sequence

MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSLAITDLLLGLL      1 - 70
VLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLV     71 - 140
LIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVAR    141 - 210
DQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYAN    211 - 280
SALNPILYAALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEV    281 - 350
TAPQGATDR                                                                 351 - 359
//

Text Mined References (71)

PMID Year Title