Property Summary

NCBI Gene PubMed Count 19
PubMed Score 210.54
PubTator Score 32.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Body Weight 14
Cardiomegaly 66

Expression

Gene RIF (9)

PMID Text
26176291 this study demonstrates a role of HRC in promoting hepatocellular carcinoma (HCC) growth, besides its role in inducing HCC metastasis, and highlights HRC as a promising intervention target for HCC.
25762622 Up-regulation of histidine-rich calcium binding protein promotes tumor metastasis in hepatocellular carcinoma and is mediated by SATB1.
24805197 The S96A HRC mutation disrupts the Ca2+ -microdomain around the RyR2, as it alters the Ca2+ -dependent association of RyR2 and HRC.
24125847 findings suggest that aberrant sarcoplasmic reticulum Ca2+ release and increased susceptibility to delayed afterdepolarizations underlie triggered arrhythmic activity in Ala96 HRC carriers
18617481 The Ser96Ala genetic variant of HRC is associated with life-threatening ventricular arrhythmias in idiopathic DCM and may serve as an independent predictor of susceptibility to arrhythmogenesis in the setting of DCM.
18617481 Observational study of gene-disease association. (HuGE Navigator)
17526652 Histidine-rich Ca-binding protein may play a key role in the regulation of SR Ca cycling through its direct interactions with SERCA2 and triadin, mediating a fine cross talk between SR Ca uptake and release in the heart.
15191886 alterations in expression levels of HRC are associated with impaired cardiac SR Ca homeostasis and contractile function.
15082771 Results identify the HRC enhancer as the first MEF2-dependent, CArG-motif-independent transcriptional target in smooth muscle and represent the first analysis of the transcriptional regulation of a sarcoplasmic reticulum gene in vivo.

AA Sequence

MGHHRPWLHASVLWAGVASLLLPPAMTQQLRGDGLGFRNRNNSTGVAGLSEEASAELRHHLHSPRDHPDE      1 - 70
NKDVSTENGHHFWSHPDREKEDEDVSKEYGHLLPGHRSQDHKVGDEGVSGEEVFAEHGGQARGHRGHGSE     71 - 140
DTEDSAEHRHHLPSHRSHSHQDEDEDEVVSSEHHHHILRHGHRGHDGEDDEGEEEEEEEEEEEEASTEYG    141 - 210
HQAHRHRGHGSEEDEDVSDGHHHHGPSHRHQGHEEDDDDDDDDDDDDDDDDVSIEYRHQAHRHQGHGIEE    211 - 280
DEDVSDGHHHRDPSHRHRSHEEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHHVPDHRHQGHRD    281 - 350
EEEDEDVSTERWHQGPQHVHHGLVDEEEEEEEITVQFGHYVASHQPRGHKSDEEDFQDEYKTEVPHHHHH    351 - 420
RVPREEDEEVSAELGHQAPSHRQSHQDEETGHGQRGSIKEMSHHPPGHTVVKDRSHLRKDDSEEEKEKEE    421 - 490
DPGSHEEDDESSEQGEKGTHHGSRDQEDEEDEEEGHGLSLNQEEEEEEDKEEEEEEEDEERREERAEVGA    491 - 560
PLSPDHSEEEEEEEEGLEEDEPRFTIIPNPLDRREEAGGASSEEESGEDTGPQDAQEYGNYQPGSLCGYC    561 - 630
SFCNRCTECESCHCDEENMGEHCDQCQHCQFCYLCPLVCETVCAPGSYVDYFSSSLYQALADMLETPEP     631 - 699
//

Text Mined References (22)

PMID Year Title
26176291 2015 Histidine-rich calcium binding protein promotes growth of hepatocellular carcinoma in vitro and in vivo.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25762622 2015 The histidine-rich calcium binding protein (HRC) promotes tumor metastasis in hepatocellular carcinoma and is upregulated by SATB1.
24805197 2014 The arrhythmogenic human HRC point mutation S96A leads to spontaneous Ca(2+) release due to an impaired ability to buffer store Ca(2+).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125847 2013 Abnormal calcium cycling and cardiac arrhythmias associated with the human Ser96Ala genetic variant of histidine-rich calcium-binding protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18617481 2008 The Ser96Ala variant in histidine-rich calcium-binding protein is associated with life-threatening ventricular arrhythmias in idiopathic dilated cardiomyopathy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17526652 2007 Histidine-rich Ca-binding protein interacts with sarcoplasmic reticulum Ca-ATPase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15191886 2004 Regulation of myocardial function by histidine-rich, calcium-binding protein.
15082771 2004 HRC is a direct transcriptional target of MEF2 during cardiac, skeletal, and arterial smooth muscle development in vivo.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12488461 2002 The human plasma proteome: history, character, and diagnostic prospects.
12480542 2003 Increased Ca2+ storage capacity in the sarcoplasmic reticulum by overexpression of HRC (histidine-rich Ca2+ binding protein).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11741309 2001 Ca(2+)-dependent interaction of triadin with histidine-rich Ca(2+)-binding protein carboxyl-terminal region.
11504710 2001 Interaction of HRC (histidine-rich Ca(2+)-binding protein) and triadin in the lumen of sarcoplasmic reticulum.
10462052 1999 Cloning, tissue distribution, subcellular localization and overexpression of murine histidine-rich Ca2+ binding protein.
2498310 1989 Purification of a sarcoplasmic reticulum protein that binds Ca2+ and plasma lipoproteins.
2037293 1991 cDNA and genomic cloning of HRC, a human sarcoplasmic reticulum protein, and localization of the gene to human chromosome 19 and mouse chromosome 7.