Property Summary

NCBI Gene PubMed Count 28
PubMed Score 15.72
PubTator Score 19.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis -1.500 3.6e-03
malignant mesothelioma -2.400 1.5e-07
astrocytic glioma -2.300 6.4e-03
posterior fossa group B ependymoma -1.900 1.8e-15
oligodendroglioma -1.900 8.8e-03
glioblastoma -1.900 9.4e-07
sonic hedgehog group medulloblastoma -2.200 3.6e-07
cystic fibrosis 2.526 1.4e-07
atypical teratoid / rhabdoid tumor -2.700 2.1e-06
medulloblastoma, large-cell -1.700 2.1e-03
primitive neuroectodermal tumor -1.200 3.0e-02
non-small cell lung cancer -1.419 1.8e-15
lung cancer -1.100 1.5e-03
active ulcerative colitis 1.023 3.5e-02
adult high grade glioma -2.500 1.8e-04
pilocytic astrocytoma -1.900 1.4e-05
subependymal giant cell astrocytoma -3.727 2.9e-03
lung adenocarcinoma -1.600 3.4e-11
lung carcinoma -1.300 7.2e-20
ovarian cancer -1.700 3.9e-11
pituitary cancer -1.900 3.5e-06

Synonym

Accession P37235 Q969S5
Symbols BDR1
HLP2
VILIP-3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
26659654 Secreted HPCAL1 protein in the plasma dropped dramatically in hepatocellular carcinoma patients relative to controls.
25019684 Results show that in the presence of calcium, N-myristoylation significantly increases the kinetic rate of VILIP adsorption to the membrane.
23873030 HPCAL1 did not appreciably influence the ability of WT PHOX2B.
21059989 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16703469 The interaction of human VILIP1 and VILIP3 with divalent cations was explored using circular dichroism and fluorescence measurement.
15834280 Observational study of gene-disease association. (HuGE Navigator)
14739275 visinin-like protein-3 interacts with microsomal cytochrome b5 in a Ca2+-dependent manner
11173883 VILIP-3 immunostaining was found to be reduced in Alzheimer brains; immunoreactive material was detected in close association with amyloid plaques and neurofibrillar tangles, typical pathologic hallmarks of AD

AA Sequence

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFR      1 - 70
TFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF                     141 - 193
//

Text Mined References (31)

PMID Year Title
26659654 2016 Hippocalcin-like 1 suppresses hepatocellular carcinoma progression by promoting p21(Waf/Cip1) stabilization by activating the ERK1/2-MAPK pathway.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25019684 2014 Specific interaction to PIP2 increases the kinetic rate of membrane binding of VILIPs, a subfamily of Neuronal Calcium Sensors (NCS) proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23873030 2014 Mutations that disrupt PHOXB interaction with the neuronal calcium sensor HPCAL1 impede cellular differentiation in neuroblastoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21059989 2011 Identification of novel loci for Alzheimer disease and replication of CLU, PICALM, and BIN1 in Caribbean Hispanic individuals.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16703469 2006 Functional contribution of Ca2+ and Mg2+ to the intermolecular interaction of visinin-like proteins.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15834280 2005 Hypertension susceptibility genes on chromosome 2p24-p25 in a general Japanese population.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14739275 2004 Neuronal calcium sensor protein visinin-like protein-3 interacts with microsomal cytochrome b5 in a Ca2+-dependent manner.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14694264 2003 Expression of visinin-like protein-3 in mouse kidney.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445467 2002 Evidence for different functional properties of the neuronal calcium sensor proteins VILIP-1 and VILIP-3: from subcellular localization to cellular function.
11964161 2002 Identification of Ca2+-dependent binding partners for the neuronal calcium sensor protein neurocalcin delta: interaction with actin, clathrin and tubulin.
11173883 Abnormal localization of two neuronal calcium sensor proteins, visinin-like proteins (vilips)-1 and -3, in neocortical brain areas of Alzheimer disease patients.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10851344 1999 Regional and cellular distribution of neural visinin-like protein immunoreactivities (VILIP-1 and VILIP-3) in human brain.
10683417 2000 The neuronal EF-hand calcium-binding protein visinin-like protein-3 is expressed in cerebellar Purkinje cells and shows a calcium-dependent membrane association.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8387172 1993 Neurocalcin family: a novel calcium-binding protein abundant in bovine central nervous system.
8038222 1994 Molecular cloning of a novel calcium-binding protein structurally related to hippocalcin from human brain and chromosomal mapping of its gene.