Property Summary

NCBI Gene PubMed Count 29
PubMed Score 17.11
PubTator Score 19.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 1.023 3.5e-02
adult high grade glioma -2.500 1.8e-04
astrocytic glioma -2.300 6.4e-03
Astrocytoma, Pilocytic -1.900 1.4e-05
atypical teratoid / rhabdoid tumor -2.700 2.1e-06
cystic fibrosis 2.526 1.4e-07
ependymoma -1.800 2.7e-02
glioblastoma -1.900 9.4e-07
lung adenocarcinoma -1.600 3.4e-11
lung cancer -1.100 1.5e-03
lung carcinoma -1.300 7.2e-20
malignant mesothelioma -2.400 1.5e-07
medulloblastoma -1.100 1.5e-02
medulloblastoma, large-cell -1.700 2.1e-03
non-small cell lung cancer -1.419 1.8e-15
oligodendroglioma -1.900 8.8e-03
ovarian cancer -1.700 3.9e-11
pituitary cancer -1.900 3.5e-06
primitive neuroectodermal tumor -1.200 3.0e-02
Rheumatoid arthritis -1.500 3.6e-03
subependymal giant cell astrocytoma -3.727 2.9e-03

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (9)

AA Sequence

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFR      1 - 70
TFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF                     141 - 193
//

Text Mined References (32)

PMID Year Title