Property Summary

NCBI Gene PubMed Count 32
PubMed Score 39.30
PubTator Score 31.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.176 4.1e-03
adult high grade glioma 1.300 1.5e-02
Astrocytoma, Pilocytic 1.300 5.9e-03
atypical teratoid / rhabdoid tumor 1.300 7.9e-04
ependymoma 1.400 5.7e-03
glioblastoma 1.400 1.2e-02
intraductal papillary-mucinous adenoma (... -1.500 1.4e-04
lung carcinoma 2.300 9.5e-18
malignant mesothelioma -1.400 3.4e-06
medulloblastoma 1.300 4.8e-02
medulloblastoma, large-cell 1.800 7.2e-03
osteosarcoma 1.526 1.1e-04
ovarian cancer 2.600 5.5e-05
pancreatic cancer 1.700 1.9e-02
primary pancreatic ductal adenocarcinoma 1.856 1.4e-02
primitive neuroectodermal tumor 2.100 1.4e-02
psoriasis 1.200 1.6e-02

Gene RIF (10)

AA Sequence

MNFEFEREIGFINSQPSLAECLTSFPAVLETFQTSSIKESTLIPPPPPFEQTFPSLQPGASTLQRPRSQK      1 - 70
RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGG     71 - 140
GGARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPDG    141 - 210
EPACPGALEDICDPAEEPAASPGGPSASRAAWEACCHPPEVVPGALSADPRPLAVRLEGAGASSPGCALR    211 - 280
GAGGLEPGPLPEDVFSGRQDSPFLPDLNFFAADSCLQLSGGLSPSLQGSLDSPVPFSEEELDFFTSTLCA    281 - 350
IDLQFP                                                                    351 - 356
//

Text Mined References (33)

PMID Year Title