Property Summary

NCBI Gene PubMed Count 55
PubMed Score 127.08
PubTator Score 75.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -3.215 4.5e-08
adult high grade glioma 2.000 1.6e-02
Breast cancer -3.600 1.4e-16
breast carcinoma -1.600 2.6e-07
cutaneous lupus erythematosus -2.900 1.1e-04
cystic fibrosis -1.837 5.6e-04
ductal carcinoma in situ -2.400 1.5e-04
glioblastoma 1.400 1.3e-02
head and neck cancer -1.300 4.1e-02
interstitial cystitis -1.700 3.5e-03
intraductal papillary-mucinous adenoma (... -1.700 3.2e-03
invasive ductal carcinoma -3.200 1.3e-04
lung adenocarcinoma -1.300 2.3e-15
lung cancer -2.800 1.9e-03
lung carcinoma -1.700 6.3e-10
malignant mesothelioma -6.500 1.8e-09
medulloblastoma 2.500 5.3e-03
non-small cell lung cancer -2.026 2.0e-19
ovarian cancer -2.600 5.9e-09
posterior fossa group A ependymoma 2.500 2.6e-05
Rheumatoid arthritis 1.200 8.1e-03
tuberculosis -1.300 2.8e-03
ulcerative colitis -1.048 3.6e-02

 GO Component (1)

Gene RIF (33)

AA Sequence

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERA      1 - 70
RSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSR     71 - 140
EGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLEL    141 - 210
EKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP              211 - 270
//

Text Mined References (56)

PMID Year Title