Property Summary

NCBI Gene PubMed Count 47
PubMed Score 113.68
PubTator Score 74.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
urothelial carcinoma -2.500 1.8e-02
adrenocortical carcinoma 2.175 1.5e-04
interstitial cystitis -2.200 1.2e-06
ovarian cancer -1.200 2.5e-05

Pathway (1)

Gene RIF (31)

PMID Text
26695677 Transfection of HOXA13 in HKCs could inhibit the degree of EMT induced by albumin-overload, possibly by increasing BMP-7 expression.
26590955 Atypical hand-foot-genital syndrome and developmental delay due to de novo mutations in HOXA13 and NRXN1
26485220 This pregnancy-maintaining regionalization of myometrial function may be mediated by HoxA13
26356815 HOXA13 promotes glioma progression in part via Wnt- and TGF-beta-induced epithelial-mesenchymal transition
26043692 study demonstrates that aberrant reduction of HOTTIP and HOXA13, which have a bidirectional regulatory loop, may play an important role in the pathogenesis of HSCR
25889214 HOTTIP/HOXA13 axis is a potential therapeutic target and molecular biomarker for pancreatic ductal adenocarcinoma.
25472883 HIV-1 Tat specifically associates with HOXA13 promoter to upregulate HOXA13 expression in T cells
25341685 serum HOXA13 may serve as a biomarker for early hepatocellular carcinoma diagnosing and predicting outcome.
24626613 the present study demonstrated that ANXA2 and SOD2 are potential target genes of HOXA13 and their coexpression predicts the poor prognosis of Esophageal squamous cell carcinoma patients.
24114970 Our study highlights the key role of HOTTIP and HOXA13 in hepatocellular carcinoma development.
23592225 Validated HOXA13 as a novel prognostic marker in gastric cancer based on immunohistochemistry and statistical analysis. HOXA13 expression was significantly up-regulated in cancerous tissues compared with the corresponding non-cancerous mucosa.
23532960 two de novo cases of hand-foot-genital syndrome associated with polyalanine expansions in HOXA13 were identified.
23376215 A total of 14 DNA sequence variations (10 novel and 4 known) within exonic and untranslated regions were detected in HOXA10 and HOXA13 among our cohorts of female genital malformations.
21971947 Hoxa9 and Hoxa13 are involved in the early and organised patterning of ENS development in the zebrafish model.
21893383 Results provide an additional support to a hypothesis that HOXA13 might participate in the carcinogenesis of esophageal squamous cell carcinoma.
21829694 conclude that the non-conserved residue, V373 is critical for structurally recognizing TAA in the major groove, and that HOXA13 dimerization is required to activate transcription of target genes
21626505 Overexpression of HOXA13 mRNA is associated with hepatocellular carcinoma.
19591980 A novel mutation of HOXA13 in a family with hand-foot-genital syndrome.
19491265 results showed that HOXA13 expression enhanced tumor growth in vitro and in vivo, and was a negative independent predictor of disease-free survival of patients with esophageal squamous cell carcinoma
19453261 Observational study of gene-disease association. (HuGE Navigator)
19423998 Vaginal HOXA13 (homeobox A13) expression is diminished in women with pelvic organ prolapse compared with women with normal support
19145497 The expression of HOXA13 can be detected in esophageal squamous cell carcinoma and is a negative independent predictor of disease-free survival.
18483557 In the absence of HOXA13 function, placental endothelial cell morphology is altered, causing a loss in vessel wall integrity, edema of the embryonic blood vessels, and mid-gestational lethality.
18245445 Maintenance of appropriate HOX transcriptional program in adult fibroblasts may serve as a source of positional memory to differentially pattern the epithelia during homeostasis and regeneration.
17935235 analysis of HOXA13 polyalanine expansion proteins in hand-foot-genital syndrome
17274802 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14675924 There seems to be no evidence that isolated hypospadias is commonly caused by mutations in HOXA13.
12112533 The chromosome translocation t(7;11)(p15;p15) in acute myeloid leukemia results in fusion of the NUP98 gene with HOXA13.
12073020 A novel stable polyalanine [poly(A)] expansion in the HOXA13 gene associated with hand-foot-genital syndrome: proper function of poly(A)-harbouring transcription factors depends on a critical repeat length?
11968094 A novel 2-bp deletion in the HOXA13 gene's highly conserved promoter region alters a key residue in the recognition helix of the homeodomain and is likely to perturb HOXA13's DNA-binding properties, resulting in both a loss and specific gain of function.
11830496 a NUP98 primer and a degenerate primer corresponding to the third helix of the NUP98 was fused in-frame to HOXA13 in the patient with MDS(myelodysplastic syndrome).

AA Sequence

MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPHPAAAAAGGNF      1 - 70
SVAAAAAAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPG     71 - 140
PAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAAAFADKY    141 - 210
MDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWA    211 - 280
LPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKD    281 - 350
KRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS                                    351 - 388
//

Text Mined References (49)

PMID Year Title
26695677 2015 [Effect of Homeobox A13 transfection on epithelial-mesenchymal transition and bone morphogenetic protein-7 expression in kidney tubular epithelial cells].
26590955 2016 Dual genetic diagnoses: Atypical hand-foot-genital syndrome and developmental delay due to de novo mutations in HOXA13 and NRXN1.
26485220 2015 HoxA13 Regulates Phenotype Regionalization of Human Pregnant Myometrium.
26356815 2015 HOXA13 is a potential GBM diagnostic marker and promotes glioma invasion by activating the Wnt and TGF-? pathways.
26043692 2015 Long none coding RNA HOTTIP/HOXA13 act as synergistic role by decreasing cell migration and proliferation in Hirschsprung disease.
25889214 2015 The long non-coding RNA HOTTIP promotes progression and gemcitabine resistance by regulating HOXA13 in pancreatic cancer.
25341685 2014 Overexpression of HOXA13 as a potential marker for diagnosis and poor prognosis of hepatocellular carcinoma.
24934387 2014 Severe manifestations of hand-foot-genital syndrome associated with a novel HOXA13 mutation.
24626613 2014 Coexpression of ANXA2, SOD2 and HOXA13 predicts poor prognosis of esophageal squamous cell carcinoma.
24114970 2014 Long noncoding RNA HOTTIP/HOXA13 expression is associated with disease progression and predicts outcome in hepatocellular carcinoma patients.
23592225 2013 Identification and validation that up-expression of HOXA13 is a novel independent prognostic marker of a worse outcome in gastric cancer based on immunohistochemistry.
23532960 2013 Analysis of de novo HOXA13 polyalanine expansions supports replication slippage without repair in their generation.
23376215 2013 HOXA10 and HOXA13 sequence variations in human female genital malformations including congenital absence of the uterus and vagina.
21971947 2012 The spatio-temporal patterning of Hoxa9 and Hoxa13 in the developing zebrafish enteric nervous system.
21893383 2011 Exploration of target genes of HOXA13 in esophageal squamous cell carcinoma cell line.
21829694 2011 Structural basis for sequence specific DNA binding and protein dimerization of HOXA13.
21626505 2011 The HOX gene network in hepatocellular carcinoma.
19591980 2010 A novel mutation of HOXA13 in a family with hand-foot-genital syndrome and the role of polyalanine expansions in the spectrum of Müllerian fusion anomalies.
19491265 2009 HOXA13 promotes cancer cell growth and predicts poor survival of patients with esophageal squamous cell carcinoma.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19423998 Diminished vaginal HOXA13 expression in women with pelvic organ prolapse.
19145497 2009 [Up-regulation of HOXA13 in esophageal squamous cell carcinoma of stage IIa and its effect on the prognosis].
18483557 2008 HOXA13 Is essential for placental vascular patterning and labyrinth endothelial specification.
18245445 2008 A dermal HOX transcriptional program regulates site-specific epidermal fate.
17935235 2007 Molecular characterization of HOXA13 polyalanine expansion proteins in hand-foot-genital syndrome.
17274802 2007 Correlation between genetic variations in Hox clusters and Hirschsprung's disease.
15617687 2005 Range of HOX/TALE superclass associations and protein domain requirements for HOXA13:MEIS interaction.
14675924 2003 Exclusion of WTAP and HOXA13 as candidate genes for isolated hypospadias.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414828 2002 Severe digital abnormalities in a patient heterozygous for both a novel missense mutation in HOXD13 and a polyalanine tract expansion in HOXA13.
12112533 2002 The chromosome translocation t(7;11)(p15;p15) in acute myeloid leukemia results in fusion of the NUP98 gene with a HOXA cluster gene, HOXA13, but not HOXA9.
12073020 2002 A novel stable polyalanine [poly(A)] expansion in the HOXA13 gene associated with hand-foot-genital syndrome: proper function of poly(A)-harbouring transcription factors depends on a critical repeat length?
11968094 2002 A HOXA13 allele with a missense mutation in the homeobox and a dinucleotide deletion in the promoter underlies Guttmacher syndrome.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11830496 2002 Single-translocation and double-chimeric transcripts: detection of NUP98-HOXA9 in myeloid leukemias with HOXA11 or HOXA13 breaks of the chromosomal translocation t(7;11)(p15;p15).
11688568 2001 Functional specificity of the Hoxa13 homeobox.
11206481 2001 Human HOX gene mutations.
10839976 2000 Novel HOXA13 mutations and the phenotypic spectrum of hand-foot-genital syndrome.
10835276 2000 Selection of homeotic proteins for binding to a human DNA replication origin.
10656931 2000 Evolution of N-terminal sequences of the vertebrate HOXA13 protein.
10569982 1999 Infertility in adult hypodactyly mice is associated with hypoplasia of distal reproductive structures.
9847074 1998 Toward a complete human genome sequence.
9020844 1997 Mutation of HOXA13 in hand-foot-genital syndrome.
8646877 1996 Fine mapping of human HOX gene clusters.
2574852 1989 The human HOX gene family.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.