Property Summary

NCBI Gene PubMed Count 55
PubMed Score 103.63
PubTator Score 74.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 2.5e-05
adrenocortical carcinoma 1428 1.5e-04
interstitial cystitis 2312 3.9e-04
urothelial carcinoma 318 1.8e-02
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count
hand-foot-genital syndrome 9

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma 2.175 1.5e-04
interstitial cystitis -1.800 3.9e-04
ovarian cancer -1.200 2.5e-05
urothelial carcinoma -2.500 1.8e-02

 GWAS Trait (1)

Gene RIF (38)

AA Sequence

MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPHPAAAAAGGNF      1 - 70
SVAAAAAAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPG     71 - 140
PAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAAAFADKY    141 - 210
MDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWA    211 - 280
LPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKD    281 - 350
KRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS                                    351 - 388
//

Text Mined References (57)

PMID Year Title