Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 7.93

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Protein-protein Interaction (5)

Gene RIF (6)

PMID Text
26230842 results of our study identify HOOK3 as a strong candidate prognostic marker with a possible role in maintaining genomic integrity in prostate cancer, which may have potential for inclusion into clinical routine assays
25799409 Results found that downregulation of Hook3 expression slows down endosomal transport and increases beta-amyloid production suggesting that Hook3 might play a critical role in pathogenic events exacerbating Alzheimer disease.
20152126 Hook3 is recruited to pericentriolar satellites through interaction with pericentriolar material 1 protein PCM1.
17639057 A fusion product between exon 11 of HOOK3 and exon 12 of RET gene was identified by 5'RACE, and the presence of chimeric HOOK3-RET protein of 88 kDa was detected by western blot analysis with an anti-RET antibody.
17237231 Hook3 interacts with a cytoplasmic domain of scavenger receptor A
12950921 Salmonella SpiC targets the function of Hook3, a mammalian protein implicated in cellular trafficking.

AA Sequence

MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWR      1 - 70
LKISNLKKILKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIM     71 - 140
MMEESVQHVVMTAIQELMSKESPVSAGNDAYVDLDRQLKKTTEELNEALSAKEEIAQRCHELDMQVAALQ    141 - 210
EEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEAAKDDYRIRCEELEKEIS    211 - 280
ELRQQNDELTTLADEAQSLKDEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQN    281 - 350
TVSLEEELRKANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLKEKVDSLQKEKDRLRTERDSL    351 - 420
KETIEELRCVQAQEGQLTTQGLMPLGSQESSDSLAAEIVTPEIREKLIRLQHENKMLKLNQEGSDNEKIA    421 - 490
LLQSLLDDANLRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAEDSVLLKKKLEEHLEKLHEANN    491 - 560
ELQKKRAIIEDLEPRFNNSSLKIEELQEALRKKEEEMKQMEERYKKYLEKAKSVIRTLDPKQNQGAAPEI    561 - 630
QALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQ    631 - 700
ATSSRRSYPGHVQPATAR                                                        701 - 718
//

Text Mined References (25)

PMID Year Title
26230842 2015 High-Level HOOK3 Expression Is an Independent Predictor of Poor Prognosis Associated with Genomic Instability in Prostate Cancer.
25799409 2015 Hook proteins: association with Alzheimer pathology and regulatory role of hook3 in amyloid beta generation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20152126 2010 Hook3 interacts with PCM1 to regulate pericentriolar material assembly and the timing of neurogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18799622 2008 An FTS/Hook/p107(FHIP) complex interacts with and promotes endosomal clustering by the homotypic vacuolar protein sorting complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17639057 2007 HOOK3-RET: a novel type of RET/PTC rearrangement in papillary thyroid carcinoma.
17237231 2007 The microtubule-binding protein Hook3 interacts with a cytoplasmic domain of scavenger receptor A.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15882442 2005 A novel hook-related protein family and the characterization of hook-related protein 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15075236 2004 IIGP, a member of the IFN inducible and microbial defense mediating 47 kDa GTPase family, interacts with the microtubule binding protein hook3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12950921 2003 The Salmonella SpiC protein targets the mammalian Hook3 protein function to alter cellular trafficking.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11238449 2001 The Golgi-associated hook3 protein is a member of a novel family of microtubule-binding proteins.
9927460 1999 Genetic analysis of hook, a gene required for endocytic trafficking in drosophila.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.