Property Summary

NCBI Gene PubMed Count 78
PubMed Score 191.04
PubTator Score 97.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer -1.200 1.8e-02
Waldenstrons macroglobulinemia 1.828 4.5e-03
Multiple myeloma 2.536 2.1e-04
psoriasis -1.100 9.9e-04
osteosarcoma -2.196 7.4e-05
group 3 medulloblastoma 2.100 1.2e-04
astrocytoma 1.400 2.1e-03
medulloblastoma, large-cell 1.600 3.1e-06
acute quadriplegic myopathy 1.506 4.0e-07
adrenocortical carcinoma -1.331 1.3e-03
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
cystic fibrosis -1.300 4.2e-05
atypical teratoid/rhabdoid tumor 1.100 1.3e-05
Breast cancer -1.100 1.6e-06
ovarian cancer 1.700 1.4e-04

Gene RIF (34)

PMID Text
27041735 mutual regulatory mechanisms exist between PP4 and SAF-A. Interactions between PP4 and SAF-A played a role in prometaphase/metaphase transition.
26881882 CENP-W interacts with hnRNPU and may contribute to kinetochore-microtubule attachment in mitotic cells.
25986610 both phosphorylation and dephosphorylation of SAF-A serine 59 by PLK1 and PP2A, respectively, are required for accurate and timely exit from mitosis.
25378556 Nuclear TDP-43 becomes neurotoxic by escaping from the inhibitory regulation by hnRNP-U or hnRNP-A2. hnRNP-U inhibits TDP-43-mediated alterations in splicing of POLDIP3 mRNA.
23811339 demonstrate that H19 inhibits RNA Pol II-mediated transcription by disrupting the hnRNP U-actin complex
23396972 Induction of caspase-9b expression is due to activation of hnRNP L via phosphorylation to compete/inhibit hnRNP U association with exon 3 of Casp9 mRNA.
23255807 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
23125841 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
22944692 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
22902625 the hnRNP-U protection of cells after oxidative stress is largely due to enhancement of NEIL1-mediated repair.
22810585 experimentally verified the targets heterogeneous nuclear ribonucleoprotein U, phosphatidylinositol-3-OH kinase, the WNK (with-no-lysine) kinase family and USP19 (ubiquitin-specific peptidase 19) as vulnerable nodes in the host cellular defence system against viruses
22678713 The results suggest that NCRNA00201 is not a major gene for microcephaly and corpus callosum abnormalities but is a good candidate for intellectual disability and seizures.
22678713 These results suggest that HNRNPU, FAM36A, and NCRNA00201 are not major genes for microcephaly and corpus callosum abnormalities but are good candidates for intellectual disability (ID) and seizures.
22325991 hnRNP U is a regulator of SMN2 splicing.
22174317 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
22162999 SAF-A interacts with BRG1 and both components are required for RNA Polymerase II Mediated Transcription
21242313 The nuclear scaffold protein (SAF-A) is a novel spindle regulator that plays an essential role in kinetochore-microtubules (MT)attachment and mitotic spindle organization.
20554522 hnRNP U/SAF-A/SP120 regulates the enzyme DNA Topoisomerase IIbeta in dual ways
20382278 Single nucleotide polymorphism in HNRPU gene is associated with speech delay, seizures and variable corpus callosum thickness.
20150277 Ash2l and Saf-A are recruited to the inactive X chromosome at the onset of stable X inactivation.
19808671 Data demonstrate that expression levels of hnRNP A1, Q, K, R, and U influence HIV-1 production by persistently infected astrocytes, linking these hnRNPs to HIV replication.
19808671 Human hnRNP U1 protein binding to splicing-incompetent U1 snRNA binding sites suffices to augment cross-exon interactions and spicing at 3'ssA2, leading to modulate HIV-1 vpr mRNA and Vpr protein expression
19617346 Data demonstrate that hnRNP U is involved in HP1alpha function, shedding new light on the mode of action of HP1alpha and on the function of hnRNP U.
19351595 hnRNP-U is phosphorylated at Ser59 by DNA-PK in vitro and in cells in response to DNA double-strand breaks.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18976975 Knockdown of heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A; HNRNPU) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18710935 The histone acetyltransferase (HAT) PCAF associates with actin and hnRNP U.
18618731 the spatial proximities among a constellation of functionally related sites that are found within euchromatic regions of the cell nucleus including: HP1gamma, RNA polymerase II, matrin 3, and SAF-A sites
16924231 These findings increase our knowledge of how WT1 exerts its transcriptional regulatory role and suggests that hnRNP-U may be a candidate Wilms' tumour gene at 1q44.
16916646 The results suggest that HIV-1 requires machinery for the nuclear export of viral mRNAs that can be specifically blocked by an interfering gene.
15364944 PRMT1 has a role in arginine methylation of SAF-A
15096513 Heterogeneous nuclear ribonuclear protein U associates with YAP and regulates its co-activation of Bax transcription
11909954 Scaffold/matrix attachment region elements interact with a p300-scaffold attachment factor A complex and are bound by acetylated nucleosomes.
11850407 hnRNP-U engages a highly neddlylated active SCF beta-TRCP which dissociates in the presence of a high-affinity substrate, resulting in the ubiquitination of the latter.

AA Sequence

MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRS      1 - 70
GAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQE     71 - 140
GEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQA    141 - 210
GGKKKAEGGGGGGRPGAPAAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEED    211 - 280
EHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLY    281 - 350
TKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELS    351 - 420
YAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKG    421 - 490
PEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAP    491 - 560
QCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPE    561 - 630
HAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF    631 - 700
NRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGN    701 - 770
YNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY                   771 - 825
//

Text Mined References (95)

PMID Year Title
27041735 2016 Protein phosphatase 4 plays dual roles during cell proliferation.
26881882 2016 Centromere Protein (CENP)-W Interacts with Heterogeneous Nuclear Ribonucleoprotein (hnRNP) U and May Contribute to Kinetochore-Microtubule Attachment in Mitotic Cells.
25986610 2015 Phosphorylation of SAF-A/hnRNP-U Serine 59 by Polo-Like Kinase 1 Is Required for Mitosis.
25616961 2015 ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1.
25378556 2015 Nuclear TDP-43 causes neuronal toxicity by escaping from the inhibitory regulation by hnRNPs.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23811339 2013 H19 inhibits RNA polymerase II-mediated transcription by disrupting the hnRNP U-actin complex.
23640942 2013 Subcellular localization and RNP formation of IGF2BPs (IGF2 mRNA-binding proteins) is modulated by distinct RNA-binding domains.
23396972 2013 hnRNP U enhances caspase-9 splicing and is modulated by AKT-dependent phosphorylation of hnRNP L.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22902625 2012 Enhancement of NEIL1 protein-initiated oxidized DNA base excision repair by heterogeneous nuclear ribonucleoprotein U (hnRNP-U) via direct interaction.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22810585 2012 Viral immune modulators perturb the human molecular network by common and unique strategies.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22678713 2012 Molecular characterization of 1q44 microdeletion in 11 patients reveals three candidate genes for intellectual disability and seizures.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22325991 2012 Nuclear matrix factor hnRNP U/SAF-A exerts a global control of alternative splicing by regulating U2 snRNP maturation.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22162999 2011 SAF-A forms a complex with BRG1 and both components are required for RNA polymerase II mediated transcription.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21242313 2011 The nuclear scaffold protein SAF-A is required for kinetochore-microtubule attachment and contributes to the targeting of Aurora-A to mitotic spindles.
20858735 2010 Interactions of ErbB4 and Kap1 connect the growth factor and DNA damage response pathways.
20554522 2010 Regulation of DNA Topoisomerase IIbeta through RNA-dependent association with heterogeneous nuclear ribonucleoprotein U (hnRNP U).
20382278 Four patients with speech delay, seizures and variable corpus callosum thickness sharing a 0.440 Mb deletion in region 1q44 containing the HNRPU gene.
20150277 2010 The Trithorax group protein Ash2l and Saf-A are recruited to the inactive X chromosome at the onset of stable X inactivation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19808671 2009 Identification of a heterogeneous nuclear ribonucleoprotein-recognition region in the HIV Rev protein.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19617346 2009 Physical and functional interaction between heterochromatin protein 1alpha and the RNA-binding protein heterogeneous nuclear ribonucleoprotein U.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19351595 2009 hnRNP-U is a specific DNA-dependent protein kinase substrate phosphorylated in response to DNA double-strand breaks.
19174163 2009 Proteomic and genomic analysis of PITX2 interacting and regulating networks.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18710935 2008 The histone acetyltransferase PCAF associates with actin and hnRNP U for RNA polymerase II transcription.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18618731 2008 Identifying functional neighborhoods within the cell nucleus: proximity analysis of early S-phase replicating chromatin domains to sites of transcription, RNA polymerase II, HP1gamma, matrin 3 and SAF-A.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18082603 2007 Purification of human telomerase complexes identifies factors involved in telomerase biogenesis and telomere length regulation.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16924231 2007 hnRNP-U directly interacts with WT1 and modulates WT1 transcriptional activation.
16916646 2006 Inhibition of HIV-1 gene expression by a fragment of hnRNP U.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15711563 2005 Actin and hnRNP U cooperate for productive transcription by RNA polymerase II.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364944 2004 Arginine methylation of scaffold attachment factor A by heterogeneous nuclear ribonucleoprotein particle-associated PRMT1.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15096513 2004 Heterogeneous nuclear ribonuclear protein U associates with YAP and regulates its co-activation of Bax transcription.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12855701 2003 The proximal region of the 3'-untranslated region of cyclooxygenase-2 is recognized by a multimeric protein complex containing HuR, TIA-1, TIAR, and the heterogeneous nuclear ribonucleoprotein U.
12840015 2003 Nuclear coactivator-62 kDa/Ski-interacting protein is a nuclear matrix-associated coactivator that may couple vitamin D receptor-mediated transcription and RNA splicing.
12686378 2003 Circadian expression of hnRNP U, a nuclear multi-potent regulatory protein, in the murine suprachiasmatic nucleus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11909954 2002 Scaffold/matrix attachment region elements interact with a p300-scaffold attachment factor A complex and are bound by acetylated nucleosomes.
11850407 2002 Pseudosubstrate regulation of the SCF(beta-TrCP) ubiquitin ligase by hnRNP-U.
11850402 2002 PABP1 identified as an arginine methyltransferase substrate using high-density protein arrays.
11813259 2002 Necdin interacts with the ribonucleoprotein hnRNP U in the nuclear matrix.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10671544 2000 Apoptotic cleavage of scaffold attachment factor A (SAF-A) by caspase-3 occurs at a noncanonical cleavage site.
10490622 1999 hnRNP U inhibits carboxy-terminal domain phosphorylation by TFIIH and represses RNA polymerase II elongation.
10348913 1999 Retrovirus integration site Mintb encoding the mouse homolog of hnRNP U.
9563502 1998 Polypyrimidine tract-binding protein interacts with HnRNP L.
9405365 1997 The novel SAR-binding domain of scaffold attachment factor A (SAF-A) is a target in apoptotic nuclear breakdown.
9353307 1997 The glucocorticoid receptor is associated with the RNA-binding nuclear matrix protein hnRNP U.
9105675 1997 The class III POU factor Brn-4 interacts with other class III POU factors and the heterogeneous nuclear ribonucleoprotein U.
9079809 1997 Thymocyte activation induces the association of phosphatidylinositol 3-kinase and pp120 with CD5.
8943344 1996 A novel membrane glycoprotein, SHPS-1, that binds the SH2-domain-containing protein tyrosine phosphatase SHP-2 in response to mitogens and cell adhesion.
8670859 1996 A novel nuclear structure containing the survival of motor neurons protein.
8068679 1994 Purification of two isoforms of hnRNP-U and characterization of their nucleic acid binding activity.
7993898 1994 Major cell surface-located protein substrates of an ecto-protein kinase are homologs of known nuclear proteins.
7831290 1995 Human spleen tyrosine kinase p72Syk associates with the Src-family kinase p53/56Lyn and a 120-kDa phosphoprotein.
7753047 1995 Binding sites of the Epstein-Barr virus and C3d receptor (CR2, CD21) for its three intracellular ligands, the p53 anti-oncoprotein, the p68 calcium binding protein and the nuclear p120 ribonucleoprotein.
7509195 1994 hnRNP-U/SAF-A is encoded by two differentially polyadenylated mRNAs in human cells.
1628625 1992 Primary structure and binding activity of the hnRNP U protein: binding RNA through RGG box.