Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.65
PubTator Score 9.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.400 3.4e-03
medulloblastoma, large-cell -1.100 2.6e-04
osteosarcoma -1.840 2.7e-06
ovarian cancer -1.100 3.1e-04
primary pancreatic ductal adenocarcinoma 1.417 5.1e-04
tuberculosis -1.400 3.4e-06

Gene RIF (4)

AA Sequence

MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH      1 - 70
KVSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADEPVYIAG     71 - 140
QQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMV    141 - 210
EFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILG    211 - 280
EHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS    281 - 350
RVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFEL    351 - 420
EDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDA    421 - 490
KPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSSHL                      491 - 542
//

Text Mined References (25)

PMID Year Title