Property Summary

NCBI Gene PubMed Count 388
PubMed Score 1303.76
PubTator Score 1022.57

Knowledge Summary

Patent (56,218)

Expression

  Differential Expression (5)

Protein-protein Interaction (2)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
651674 screening 1736 / 0 / 513 Counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical high throughput assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization
651720 confirmatory 133 / 0 / 101 Counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical high throughput dose response assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization
651760 confirmatory 8 / 0 / 40 Late stage counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical dose response assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization
652123 confirmatory 15 / 0 / 33 Late stage counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical dose response assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization (ROUND 2)
652137 confirmatory 0 / 0 / 6 Late stage counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical dose response assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization (ROUND 3)

Gene RIF (358)

PMID Text
27011261 Berberine has an effect on hepatic gluconeogenesis and lipid metabolism and is mediated through HNF-4alpha and regulated downstream of miR122
26926107 ETS2, HNF4A and JUNB are synergistic master regulators of epithelial-to-mesenchymal transition in cancer.
26743282 HNF4alpha expression analysis revealed that pre-exposing the cells with FGF4 was more effective in hepatocyte differentiation.
26692490 In conclusion, our data indicate that HNF-4alpha may have a wider role in cell and plasma cholesterol homeostasis by controlling the expression of LXRalpha in hepatic cells.
26624507 PHD2 suppresses the activity of TGF-beta1 pathway and consequently maintains the expression of hepatocyte nuclear factor-4alpha
26561320 Studied the role and putative interactors of SNAI2, a slug protein which is involved in the development of cancer progression. Based upon the computational analysis, we consider HNF4A could be a putative candidate to study zinc finger protein slug.
26446475 rejected the hypothesis that all human MODY-associated mutations in HNF1A / HNF4A induce changes in the pharmacokinetics of sulfonylureas in humans analogically to the Hnf1a(-/-) mouse model
26302721 In conclusion, our study revealed a novel mechanism by which TSH regulated the hepatic HNF-4alpha subcellular localization.
26272613 These results suggest that the flavonoid luteolin ameliorates an atherogenic lipid profile in vivo that is likely to be mediated through the inactivation of HNF4alpha.
26241054 these data demonstrate that copper-mediated nuclear receptor dysfunction disrupts liver function in WD and potentially in other disorders associated with increased hepatic copper levels.
26240283 The HNF4a isoforms play distinct roles in colon cancer, which could be due to differential interactions with the Wnt/beta-catenin/TCF4 and AP-1 pathways.
26232425 In HepG2 cells, repression of HNF4alpha by activation of IGFBP1 gene changes cell morphology and induces cell migration.
26216285 We identified hepatocyte nuclear factor 4alpha as a regulatory factor that bound endogenous CLDN7 promoter in differentiating intestinal epithelial cells and stimulated CLDN7 promoter activity.
26213157 Polymorphisms in ABCG2 rs2231142, rs3114020, HNF4alpha rs2071197 and ABCB1 rs1128503 were found to be associated with LTG CDR.
26100857 The miR-34a-HNF4alpha pathway is activated under common conditions of metabolic stress and may have a role in the pathogenesis of NAFLD and in regulating plasma lipoprotein metabolism.
26019449 HNF4alpha can induce differentiation of hepatic stellate cells into hepatocyte-like cells.
25965999 Galpha12 overexpression in HCC inhibits MIR122 transactivation by inactivating HNF4alpha, which causes c-Met induction, contributing to cancer aggressiveness.
25819479 Clinical variations including transient liver dysfunction is a likely HNF4A p.R76W mutation -specific clinical characteristic in congenital hyperinsulinism with Fanconi syndrome.
25808746 Results showed that HNF4a is downregulated in colon carcinoma patients and its ectopic expression inhibited proliferation, migration and invasion of HT29, LoVo and SW480 cells.
25786776 HNF4alpha negatively regulates STIM1 transcription in glomerular mesangial cells.
25671620 the relation between HNF4A genetic variants and MetS and metabolic variables
25616597 HNF-4alpha was down-regulated during ER stress but the expression of C/EBPbeta varied depending on a particular form of C/EBPbeta
25592038 HNF4A exhibits oncogenic activity that affects the aggressiveness and angiogenesis of neuroblastoma through activating the transcription of MMP-14.
25445224 This study indicates that the competitive actions of HNF-1alpha and HNF-4alpha on their overlapping binding sites in the human BCMO1 gene promoter oppositely regulate BCMO1 gene expression in the human small intestine.
25422324 our results reveal a novel Hnf4alpha/miR-122/GALNT10 regulatory pathway that facilitates EGF miR-122 activation and hepatoma growth in HBV-associated hepatocarcinogenesis.
25410163 Results indicate that HNF4alpha is a targetable oncoprotein in gastric cancer, is regulated by AMPK signalling through AMPKalpha and resides upstream of WNT signalling.
25400315 SNP rs1884613 contributes to susceptibility to prediabetes, whereas this polymorphism may not play an important role in the development of T2D.
25361053 This study supports the T130I variant in HNF4A as a major susceptibility genotype associated with early-onset type 2 diabetes mellitus.
25356900 Around 42.5% of the overall interindividual variability in warfarin dose requirements was explained : VKORC1 genotype accounted for 29.6%, CYP2C9 genotype for 4.3%, age for 3.6%, the CYP4F2 genotype for 3.3%, and CAR/HNF4alpha (rs2501873/rs3212198) for 1.7%
25355887 Authors show that the transcription factor hepatocyte nuclear factor 4alpha (HNF4alpha) is a target of HBx-regulated AKT, and link HNF4alpha to HBx-regulated AKT modulation of hepatitis B virus transcription and replication.
25242412 CXCR7 participates in the differentiation of HCC by regulating HNF4A.
25209865 data suggest that nuclear receptor family member HNF4alpha contributes to the transcriptional regulation of SLC2A9 isoform 1
25056436 HNF-4alpha most likely plays an essential role in the initiation of OTC transcription in human.
24828613 Adiponectin increases hepatic production of sex hormone binding globulin (SHBG) by upregulating HNF-4alpha levels via changes in hepatic lipid content.
24819304 HNF4alpha coordinates with retinoic acid receptors in a retinoic acid-dependent manner to strongly induce CYP26A1 gene expression in the liver, which may explain the high level of response to retinoic acid observed in vivo.
24752868 HNF4alpha-NF-kappaB feedback circuit including miR-124, miR-7, and miR-21 identified in hepatocellular carcinoma
24713057 HNF4alpha isoform switching may be an early event in Barrett's pathogenesis.
24711169 HNF4A is a very good marker to discriminate between primary and metastatic gastric and breast carcinomas
24619225 Data indicate that pyruvate kinase PKM1 regulates miR-124 expression via hepatocyte nuclear factor 4 (HNF4alpha).
24559927 Data suggest that HNF4A is involved in regulation of both cellular response to endoplasmic reticulum stress and cell function (glucose-stimulated insulin secretion) in pancreatic beta cells. [REVIEW]
24463962 Alternative human liver transcripts of TCF7L2 bind to the gluconeogenesis regulator HNF4alpha at the protein level.
24448600 The Thr130Ile polymorphism of HNF4A is associated with gestational diabetes in a Mexican population.
24399729 Glucocorticoid receptor-induced expression of HNF4alpha may contribute to indirect OCT1 gene up-regulation by dexamethasone in primary human hepatocytes.
24384557 Results suggest that PXR*1B, in combination with HNF4alpha rs2071197, might be associated with the concentration-to-dose ratios and the duration to reach the maintenance dose of carbamazepine therapy.
24323243 Mutations in GCK, HNF1A or HNF4A genes were detected in 58 of 150 individuals. Parents of 28 probands were unavailable for further analysis, and in 19 probands the mutation was inherited from an asymptomatic parent.
24299156 Maturity-onset diabetes of the young can develop as early as the first decade of life in persons with an HNF4A mutation. Impaired incretin response might be contributory in the early stages of HNF4A maturity-onset diabetes of the young.
24285859 the HNF4A R76W mutation is an unusual example of a mutation specific phenotype, with autosomal dominant atypical Fanconi syndrome in addition to the established beta cell phenotype
24177414 Mild hypoxic conditions in response to aging-dependent hepatic structural changes may contribute to the induction of the gluconeogenic enzyme PEPCK through HNF4alpha protein stabilization.
24101726 A feedback mechanism controlling Wnt-beta-catenin signaling and HNF4alpha expression in hepatocellular carcinoma epithelial to mesenchymal transition.
24059685 HNF4alpha might play a crucial role in the metastatic tumor formation of HCC, and the mechanism may be related with the process of phenotype transition.
24000795 HNF4a is present in both T lymphocytes and granulocytes, suggesting a previously unsuspected role for this transcription factor in regulating leukocyte function and therapeutic response in juvenile idiopathic arthritis
23981200 It is involved in hepatic gene transcription in patients undergoing curative resection for hepatocellular carcinoma (HCC).
23878349 Heterozygous mutations in the GCK and HNF1A/ HNF4A genes account for up to 80% of all Maturity onset diabetes of the young cases. (Review)
23874642 These results indicate that the N-terminal domain of SHP is important for its nuclear translocation via HNF4alpha.
23803251 PSP/reg and CRP are differentially regulated by HNF1A and HNF4A in maturity-onset diabetes of the young
23775631 we have identified a novel mechanism by which HNF4alpha reverses HCC malignancy through up-regulation of an miRNA cluster in the DLK1-DIO3 region, particularly miR-134.
23652628 2 novel HNF4A mutations were found in 2 Japanese MODY1 families. 1 demonstrated a heterozygous missense mutation in exon 7. the other showed a heterozygous frame shift mutation in exon 6.
23628799 HNF4alpha up-regulates C3 gene expression in HepG2 cells.
23551881 report of 2 sisters with childhood onset diabetes who are both heterozygous for the most common mutation in each of 2 transcription factors, HNF1A, and HNF4A; study of genotypes and phenotypes within the family to investigate the digenic inheritance
23354620 Genetic variants of CYP7A1 and its transcriptional activators (HNF4A and PPARGC1A) may activate bile acid synthesis, resulting in the accumulation of bile acids in hepatocytes leading primary biliary cirrhosis progression.
23348805 identification of an HNF1A or HNF4A gene mutation has important implications for clinical management in diabetes and pregnancy, but MODY is significantly underdiagnosed.
23307400 Data indicate that HDAC inhibitor targeting of HNF-4alpha may serve as an effective treatment for advanced colon carcinomas, since downstream cancer-associated target genes such as MUC4 are significantly down-regulated by this treatment.
23292115 investigation of HNF4alpha genetic polymorphisms may improve the predictability of CYP2D6 activity in different populations
23268925 A total of 69 polymorphisms were identified in the genomic region of NR2A1 in Chinese, Malays and Indians, of which thirty-three were novel polymorphisms with low allelic frequencies (<0.02).
23108025 HNF4 alpha labeled all of the invasive mucinous adenocarcinoma of the lung except the ALK-positive adenocarcinomas.
23052196 Arsenite induced down-regulation of HNF1alpha and HNF4alpha under chronic settings may play a central role in the features of disease and cancer observed both in vivo and in vitro.
23038264 HNF4alpha and LRH-1 promote active transcription histone marks on the Cyp7a1 promoter that are reversed by FGF19 in a SHP-dependent manner
22960426 GSK3beta chemical inhibition results in HNF4alpha DNA binding impairment while a constitutively active GSK3beta mutant impairs the TGFbeta-induced inhibitory effect on HNF4alpha tumor suppressor activity.
22952853 the identification of MED25 as one of the HNF4alpha binding partners in pancreatic ss-cells leading to insulin secretion which is impaired in MODY patients
22914433 six SNPs were significantly associated with pediatric Crohn's disease
22902540 IL1beta treatment reduces SHBG production in HepG2 cells by the down-regulation of HNF-4A via the MAPK kinase (MEK)-1/2 and c-Jun N-terminal kinase (JNK) MAPK signaling pathways.
22802087 The effects of HNF4A mutations in infancy may extend beyond pancreatic beta-cells to produce a disorder similar to glucose transporter 2 deficiency involving both liver glycogen metabolism and renal tubular transport.
22791717 Mucroporin-M1 peptide can activate the MAPK pathway and then reduce the expression of HNF4alpha, resulting in the inhibition of HBV replication in vitro and in vivo.
22628013 functional analysis of lethal factor VII deficiency due to novel mutations in the F7 promoter reveals disruption of HNF4 binding site
22505616 Analyses indicate that SUMOylation of HNF4alpha plays an important role during hepatocellular differentiation and this is mediated, in part, through regulation of the stability of HNF4alpha in a ubiquitin-dependent manner.
22432108 In the type 1 diabetic group, two HNF1A mutations were found (0.8% prevalence). In type 2 diabetic subjects, 10 HNF1A, two HNF4A, and one GCK mutation were identified
22383578 HNF4-specific DNA recognition and transactivation are mediated by residues Asp69 and Arg76 in the DNA-binding domain.
22357705 a novel mechanism of MTP repression that involves binding of NR2F1 to the DR1 element and recruitment of corepressors
22333269 Suggest that lower expression of HNF4alpha and PGC1alpha may impair rifampicin-mediated CYP3A4 induction under conditions of PXR overexpression in fetal liver cells.
22308320 three SNPs in the human HNF4alpha protein, two of which are in the HNF4alpha F domain that interacts with the Src SH3 domain, increase phosphorylation by Src and decrease HNF4alpha protein stability and function
22282358 HNF4alpha regulates human hepatic ABCA1 expression in response to cholesterol depletion.
22240483 Estrogen can repress transcription of HBV genes by up-regulating ER-alpha, which interacts with and alters binding of HNF-4alpha to the HBV enhancer I.
22155889 HNF4alpha positively regulates ACAT2 gene expression at mRNA level. Overexpression of HNF4alpha increased ACAT2 expression, whereas knockdown of HNF4alpha decreased ACAT2 expression.
22153071 Study shows that transient inhibition of HNF4alpha initiates hepatocellular transformation through a microRNA-inflammatory feedback loop circuit consisting of miR-124, IL6R, STAT3, miR-24, and miR-629.
22140441 miR-34a and miR-21 cooperate in downregulation of the HNF4A mRNA.
22068426 HNF4alpha might play an important role in the hepatic differentiation from human ESC-derived hepatoblasts by activating the MET.
22060211 In Japanese patients with pediatric-onset MODY-type diabetes, mutations in known genes were identified at a much higher frequency than previously reported for adult Asians.
21983932 HNF4 alpha single nucleotide polymorphisms and haplotypes contributed to increased type 2 diabetes risk in the Malaysian population.
21922456 A mutation within the hepatic nuclear factor 4A (HNF-4A) gene hitherto unreported for MODY-1.
21852396 HNF4A is essential for specification of hepatic progenitors from human pluripotent stem cells
21831733 Our data suggest that HNF4A variants play a role in the pathogenesis of ulcerative colitis in Koreans.
21814221 The variants in HNFA and NEUROG3 indicate a strong predisposition of normal-weight/lean subjects to T2D in North Indians.
21799848 pORF3 increases HNF4 phosphorylation through the ERK and Akt kinases
21760481 The -60 T-->C mutation in the factor VII strongly diminishes functional interaction between the FVII promoter and transcription factor HNF4alpha contributing to severe factor VII deficiency in homozygous twins.
21744425 We confirmed the association between ulcerative colitis and HNF4alpha.
21733563 hepatocyte nuclear factor 4A is an excellent marker for differentiating metastatic breast carcinomas from primary gastric carcinomas
21725089 control network for Egr-1 expression through a feedback loop between SHP and HNF4alpha.
21708125 multiple post-translational modifications were newly identified in HNF4alpha and unexpected role of an HNF4alpha acetylation could be uncovered.
21683639 study to establish the occurrence of HNF1A and HNF4A mutations in subjects classified clinically as MODY to identify novel mutations and to determine phenotypic features and response to therapy; two novel HNF4A mutations were idedntified
21646355 l type-specific target selection by combinatorial binding of Smad2/3 proteins and hepatocyte nuclear factor 4alpha in HepG2 cells.
21633728 subjects with hepatocyte nuclear factor 4 alpha P2 variants and haplotypes have been shown to have a higher insulin resistance and are therefore at a higher risk for developing type 2 diabetes mellitus
21618351 HNF4alpha expression was significantly decreased in patients with active ulcerative colitis (UC)compared to UC patients in remission and healthy controls.
21494118 HNF4alpha protein expression is an independent predictor of favorable prognosis in carcinoma of the papilla of Vater and may serve for risk stratification after curative resection.
21493011 This is the first report to demonstrate HNF-4alpha expression in a primary hepatoid adenocarcinoma of the uterine corpus, a rare uterine tumor.
21442235 Results indicate the interaction between HNF4A and FOXO1 genes in the pathogenesis of type 2 diabetes.
21384409 The role of HNF4alpha in induction and maintenance of hepatocyte differentiation should also be ascribed to its capacity to continuously repress the mesenchymal program. HNF4alpha activator and repressor functions are necessary for the identity of hepatocytes.
21352552 HNF4alpha acts as a global regulator of liver-specific gene expression.
21323639 Maturity onset diabetes of the young mutations in HNF$A are loss-of-function mutations leading to impaired beta-cell function.
21062980 Findings point to the nuclear receptor HNF4alpha as a potential therapeutic target to eradicate aberrant epithelial cell resistance to ROS production during intestinal tumorigenesis.
21062274 Minor allele frequency of rs1884614 and rs2071197 was significantly lower in early onset T2DM, and minor allele frequency of Val255Met was significantly lower in maturity onset diabetes of the young compared to normal subjects.
21062274 Observational study of gene-disease association. (HuGE Navigator)
21047794 the native HNF4alpha isoform, phosphorylation status, and complexes in the steady-state.
21047794 Native state of HNF4alpha isoforms, phosphorylation status, and interactive cofactores were revealed by proteomic analysis
20976847 Overexpression of HNF-4alpha improves the hepatic differentiation of human mesenchymal stem cells from bone marrow.
20931292 Congenital hyperinsulinism due to mutations in HNF4A and HADH.
20878384 Our data are consistent with low-frequency, non-synonymous variants in HNF4A influence type 2 diabetes risk, but are not conclusive when judged against stringent standards for genome-wide significance.
20878384 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20871093 HNF4alpha appears to play a key role in intestinal lipid metabolism as well as intestinal anti-oxidative and anti-inflammatory defense mechanisms.
20863361 Observational study of gene-disease association. (HuGE Navigator)
20735474 The site-directed mutagenesis of HNF-4 binding sites in the transthyretin proximal promoter dramatically decreases transthyretin.
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20705777 The proband carrying both the HNF4A/MODY1 and HNF1A/MODY3 shows a more severe form of diabetes compared with the family members carrying only one mutation.
20684663 These results suggest that the high-level angiotensinogen expression in the kidney is, at least in part, due to a presence of high-affinity HNF4 binding sites in its promoter.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20670916 The level of PGC-1alpha determines whether the cAMP/PKA-pathway overall stimulates or inhibits HNF-4alpha transcriptional activation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622021 CCAAT/enhancer-binding protein alpha (C/EBPalpha) and hepatocyte nuclear factor 4alpha (HNF4alpha) synergistically cooperate with constitutive androstane receptor to transactivate the human cytochrome P450 2B6 (CYP2B6) gene
20576917 These results indicate that inactivation of HNF-4alpha due to oxidative stress and zinc deficiency is likely a novel mechanism contributing to the deleterious effects of alcohol on the tight junctions and the intestinal barrier function.
20558840 association of promoter region SNPS rs1884614 and rs2425637 and type 2 diabetes risk in Chinese
20558840 Observational study of gene-disease association. (HuGE Navigator)
20546279 Two novel mutations identified here and the previously identified late-onset diabetes mutation, -192C>G, impair the function of the HNF4A P2 promoter in vitro.
20463007 regulatory pathway of ABCC6 expression showing that the ERK1/2-HNF4alpha axis has an important role in regulation of the gene
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20361036 the HNF4A and WFS1 risk alleles predispose to development of type 2 diabetes in an Ashkenazi Jewish population
20361036 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20308432 Observational study of gene-disease association. (HuGE Navigator)
20167659 Identify DGAT1 as an important protein that participates in the effect of HNF4A on hepatic secretion of triglyceride-rich lipoproteins.
20164212 In this large series, HNF4A mutations are the third most common cause of diazoxide responsive hyperinsulinemic hypoglycemia.
20164212 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20158877 results derived from visualization of our alignment data and network analysis showed that let-7 family microRNAs could affect the downstream target HNF4A, which is a known endodermal differentiation marker.
20086032 These results provide clear evidence that HNF4alpha contributes to the constitutive expression of the human CYP2C genes
20079163 Data observed that ABCC8 as well as the interaction between PPARG and HNF4A may contribute to post-challenge insulin secretion.
20079163 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20003313 Val/Met255 mutation in the HNF4alpha gene was identified in about one fourth of Iranian families affected with maturity onset diabetes of the young.
20003313 Observational study of gene-disease association. (HuGE Navigator)
19966299 Data suggest that a distinct chromatin architecture coordinated by beta-catenin/TCF-bound Wnt responsive enhancers accompanies transcriptional activation of MYC gene expression.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19934400 Observational study of gene-disease association. (HuGE Navigator)
19924231 analysis of isoform-specific expression of the human, mouse and rat HNF1A, HNF1B and HNF4A genes
19915572 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region
19915572 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19846556 Results describe the crystal structure of HNF4alpha in complex with a fragment of PGC-1alpha containing all three of its LXXLL motifs.
19805548 there is a physical and functional link between hepatocyte nuclear factor 4alpha and transcription factor IID
19761587 The HNF4alpha regulation of the Cdx-2 promoter unravels a transcription factor network also including HNF1alpha, all of which are transcription factors involved in intestinal development and gene expression.
19748811 Studies suggest that in addition to HNF4alpha variants in the promoter region, other SNPs may be involved on the occurrence of T2D.
19748811 Meta-analysis of gene-disease association. (HuGE Navigator)
19651776 Coimmunoprecipitation assay from mouse liver samples depicts that endogenous DAX-1 interacts with HNF4alpha in vivo
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575803 study evidences activity of HNF4alpha in human and rat choroid plexus
19563409 Negative expression of P1-HNF4alpha was indicated as one of the useful immunohistochemical markers in the classification of mucin phenotype of both non-neoplastic mucosa and cancers of gastric phenotype
19467232 ERG1 may loop the distal enhancer PB responsive enhancer module towards the proximal OA response element KI so that together, CAR and HNF4alpha synergistically activate the CYP2B6 promoter.
19454287 Data show a direct and hitherto unknown convergence of the canonical Wnt signaling on the HNF4alpha-driven transcription providing evidences of a mechanism controlling liver zonated gene expression.
19435525 TCF and beta-catenin binding plays important roles in HCCR-1 oncogene expression.
19406499 The effect of HNF4A polymorphisms on the risk of type 2 diabetes is influenced by physical activity.
19406499 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19389810 DHEA production is regulated by PGC-1alpha, ERRalpha, and HNF4alpha
19353766 Results describe HNF4alpha variants designated HNF4alpha10-12 expressed from distal promoter P2, and provide evidence for a more complex expression pattern of HNF4alpha than previously appreciated.
19336534 thyroid hormones increase SHBG production indirectly by increasing HNF-4alpha gene expression, and by reducing cellular palmitate levels that further contribute to increased HNF-4alpha levels in hepatocytes
19302415 These results suggest that HNF4alpha and HNF3beta likely participate in hepatitis B virus replication in hepatitis B patients, or that hepatitis B virus replication may somehow influence the expression of HNF4alpha and HNF3beta in the liver.
19228884 The CNT1 promoter was characterized with respect to DNA response elements and their binding factors are reported.
19228875 Observational study of gene-disease association. (HuGE Navigator)
19188435 Sequences and transcriptional functions are conserved between mice and humans.
19179483 Data indicate that hyperinsulinemia down-regulates HNF4alpha in the liver through the up-regulation of SREBPs, thereby establishing a link between these two critical transcription factor pathways that regulate lipid and glucose metabolism in the liver.
19154258 Hepatocyte nuclear factor 4alpha (HNF4alpha) isoform and progesterone receptor were expressed in pancreatic alpha-cells, but not beta-cells in the human pancreas.
19147806 HNF-4alpha is an important transcriptional factor that regulates human CRBPII gene expression; possibility for a novel function of HNF-4alpha in the regulation of human intestinal vitamin A absorption and metabolism
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19048623 increased transcriptional activity of HNF-4 converging onto genes coding for antiapoptotic oncogenes and cytokines may promote CRC development.
18988528 The possibility of the reversion of dedifferentiated hepatocarcinoma phenotype by means of HNF4a expression confirms the important role of this factor in the coordination of proliferation, differentiation and the maintenance of epithelial morphology.
18844932 HNF4 alpha is demonstrated to be a useful marker for histological and cytological diagnosis of ovarian mucinous tumors.
18829458 Structural basis of natural promoter recognition by a unique nuclear receptor, HNF4alpha. Diabetes gene product.
18811724 Observational study of gene-disease association. (HuGE Navigator)
18805788 HNF-4 and Foxo1 are required for reciprocal transcriptional regulation of glucokinase and glucose-6-phosphatase genes in response to fasting and feeding
18765665 COUP-TFII antagonizes the repression of the PED/PEA-15 gene by HNF-4alpha.
18728231 Data indicate that the risk conferred by HNF4A P2 is significantly different between U.K. and Ashkenazi populations (P < 0.00007), suggesting that the underlying causal variant remains unidentified.
18728231 Observational study of gene-disease association. (HuGE Navigator)
18666237 Human subjects with the HNF4A G60D genotype tended to have lower CYP2D6 activity than those with the wild-type HNF4A. The HNF4A G60D variant was detected at low frequency in Asian populations and was not found in Africans or Caucasians.
18666237 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18654034 SNP rs1884614 in the P2 promoter region of the HNF-4alpha gene may influence insulin secretion in non-obese Japanese subjects with type 2 diabetes.
18602983 Observational study of gene-disease association. (HuGE Navigator)
18561282 HNF4alpha9 & HNF4alpha3 were expressed in human Hep 3B hepatocellular carcinoma cells.
18552123 The coactivator NCOA6 mediates the mechanism of the synergistic activation of the CYP2C9 gene by CAR and HNF4alpha.
18513302 Observational study of gene-disease association. (HuGE Navigator)
18513187 HNF4alpha directly interacts with the hHSS promoter region -209/-204 in vivo and strongly represses hHSS expression.
18498634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18426912 HNF4alpha regulates thyroid hormone homeostasis through transcriptional regulation of the Dio1 gene with GATA4 and KLF9
18395097 TASP1, EPS15R, and PRPF3 expression were significantly induced in HCCs of transgenic EGF2B mice as was P2 promoter-driven HNF4alpha
18391435 In order to elucidate the molecular basis of HNF4 function in maturity onset diabetes of the young, an HNF4 DNA-binding domain is presented in complex with a high-affinity HNF1 promoter element containing the HNF4 recognition sequence.
18356407 isoforms of the HNF4A P1 promoter are expressed in human fetal, but not adult, pancreas, and their presence during pancreatic development may moderate the diabetic phenotype in mutations in the HNF4A gene.
18346225 Data show that a concerted action of HNF4alpha and HNF1alpha, which also determines morphological and functional differentiation of hepatocytes, links HBV replication to hepatocyte differentiation.
18332101 Observational study of gene-disease association. (HuGE Navigator)
18305375 A knock-down of hepatocyte nuclear factor 4alpha significantly decreased expression levels of endogenous pregnane X receptor in HepG2 tumor cells.
18305369 In this review, HNF4 alpha controls constitutive expression of many hepatic genes but under certain circumstances can be subjected to regulation by differential co-activator recruitment, by phosphorylation and by interaction with other nuclear receptors.
18268044 Macrosomic infants with transient or persistent hyperinsulinemic hypoglycemia should be screened for HNF4A mutations if there is a family history of youth-onset diabetes.
18234786 The nuclear hormone receptors hepatocyte nuclear factor 4 (HNF4) and retinoid X receptor alpha (RXRalpha) support hepatitis B virus (HBV) pregenomic RNA synthesis and viral replication in nonhepatoma cells.
18199540 Regulation of vascular endothelial growth factor D by hepatocyte nuclear factor-4 alpha and chicken ovalbumin upstream promoter transcription factors 1 and 2.
18184923 Dysregulation of HNF 4 alpha and TRPC1 may be a possible molecular rationale in diabetic nephropathy.
18163890 14 of 56 HNF4 alpha-regulated genes, including well-known cancer genes, are able to contribute to the inhibitory effect of HNF4 alpha on cell proliferation
18162503 Variation in PPARG2 and HNF4A may interact to regulate insulin sensitivity in Mexican Americans at risk for type 2 diabetes.
18162503 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18056193 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18028455 high frequency of the HNF4A T130I variant in our population & its association to early-onset type 2 diabetes(T2D)& the risk for premature chronic complication suggest an important role of this variant in the pathogenesis of T2D in the Mexican population
17992261 monosaccharide-induced lipogenesis reduced hepatic HNF-4alpha levels, which in turn attenuated SHBG expression.
17991764 Data show that HNF-4alpha is developmentally regulated in the human liver: HNF-4alpha2 and HNF-4alpha8 are expressed in fetal hepatocytes but only HNF-4alpha2 is expressed in postnatal liver.
17965524 HNF1alpha and HNF4alpha are the factors involved in the interindividual variability of liver UGT1A6 and UGT1A9 mRNA expression.
17958743 HNF-4alpha plays a crucial role in human PZ gene expression in hepatocytic cells, and Sp1 is also important
17932483 Cited2, a coactivator of HNF4alpha, is essential for liver development
17923767 HNF4alpha primarily regulatea both growth and function of islet beta-cells. [REVIEW]
17920062 TGFbeta1 represses CYP7A1 gene transcription in human hepatocytes by a mechanism involving Smad3-dependent inhibition of HNF4alpha and histone deacetylase remodeling of CYP7A1 chromatin.
17894829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17891372 Macrosomia and neonatal hypoglycaemia in RW pedigree subjects with a mutation (Q268X) in the gene encoding hepatocyte nuclear factor 4alpha.
17885207 Results suggest a general model by which a differentiation factor (HNF4alpha1) and a proliferation factor (c-Myc) may compete for control of genes involved in cell proliferation and differentiation.
17876342 Inter-individual/inter-ethnic variations of docetaxel and doxorubicin pharmacokinetics or pharmacodynamics exist, but genotypic variability of HNF4A cannot account for this variability.
17876342 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17827783 HNF4alpha plays a dominant role in the expression of drug-metabolizing enzymes and transporters
17827402 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17827402 Variation in the HNF4A region is associated with type 2 diabetes in Scandinavians.
17805472 Observational study of gene-disease association. (HuGE Navigator)
17785436 Re-expression of E-cadherin in HT29(US) cells restored the ability of caveolin-1 to down-regulate beta-catenin-Tcf/Lef-dependent transcription and survivin expression, as seen in HT29(ATCC) cells.
17764444 CYP3A4 enhancers co-ordinate the proximal promoter in responding similarly to the pregnane X receptor but differentially to hepatocyte nuclear factor-4alpha
17601994 Observational study of gene-disease association. (HuGE Navigator)
17576804 interindividual variation in the expression level of HNF4A probably determines variation in expression and activity of a broad scope of xenobiotic metabolism genes
17574576 HNF-4alpha is a crucial mediator in the regulation of alpha1-antitrypsin, transthyretin, and apolipoprotein B gene expression
17563455 HNF4A variants identified so far appear to modestly contribute to predisposition for type 2 diabetes.
17466274 Our data suggest that the LBP gene may confer genetic susceptibility to T2D and this warrants further replication study.
17464991 observations suggest that HNF4alpha1 positively regulates constitutive androstane receptor (CAR) expression in normal developing & adult livers, whereas HNF4alpha7 represses CAR gene expression in hepatocellu;lar carcinoma
17407387 Observational study of gene-disease association. (HuGE Navigator)
17407387 HNF4A plays a key role in determining foetal birthweight.
17403900 Cooperative interaction between HNF4A and GATA4 and GATA6 regulates ABCG5 and ABCG8.
17393984 HNF-4alpha expression is associated with the intestinal phenotype of non-neoplastic and neoplastic gastric glandular cells, suggesting an involvement in the establishment and maintenance of the intestinal phenotype of gastric mucosa and adenocarcinomas.
17344191 this paper reports the first characterization of the human OAT1 promoter and the first gene in the kidney whose promoter activity is regulated by HNF-4alpha
17343826 Studying genotype interactions of hFABP2 and HNF-4alpha, that are both candidate genes for diabetes type 2, may be a powerful approach.
17327436 A study evaluating the extent to which common variation in the six known maturity-onset diabetes of the young (MODY) genes, which cause a monogenic form of type 2 diabetes, is associated with type 2 diabetes is presented.
17317687 Inflammatory-redox state enhances PC4-HNF4 binding to upregulate transcription of target hepatocyte genes, such as iNOS
17300672 These findings suggest that downregulation of P1 promoter-driven HNF4alpha expression is involved in tumor metastasis and a worse prognosis.
17291450 Transcriptional regulation of cripto-1 expression by WNT signaling through an intronic-exonic enhancer element, containing three tandem TCF/LEF binding sites within the CR-1 gene.
17264800 hepatocyte nuclear factor 4alpha-mediated transcription from the human UGT1A9 promoter was discovered to be entirely dependent on hepatocyte nuclear factor 1.
17259399 Observational study of gene-disease association. (HuGE Navigator)
17259399 Results support the possibility that a variant in the P2 promoter region of HNF4A, or variants in linkage disequilibrium within this region, contributes to susceptibility to type 2 diabetes in many ethnic populations including Mexican Americans.
17052457 PRMT1 is a coactivator for HNF4, an orphan nuclear receptor that regulates the expression of genes involved in diverse metabolic pathways
17022998 Isl1 could enhance the HNF4alpha-mediated activation of transcription of the HNF1alpha, PPARalpha and insulin I promoters
17007050 Expression of Thy1 decreased in differentiated ADSC and BMSC. Expression of albumin, CYP2E1, and CYP3A4 increased in differentiated BMSC and ADSC. Hepatic gene activation may involve increased C/EBPbeta and HNF4alpha.
16980607 The results point to an absolute requirement of enhancer-promoter communication for maintaining the active state of the HNF-4 gene and provide evidence for a molecular bookmarking mechanism.
16978381 Observational study of gene-disease association. (HuGE Navigator)
16955255 Observational study of gene-disease association. (HuGE Navigator)
16946562 Thirty-nine single nucleotide variations, including 16 novel ones, were found in the 5' promoter region, all of the exons and their surrounding introns of HNF4A in 74 Japanese type II diabetic patients.
16936201 Observational study of gene-disease association. (HuGE Navigator)
16929032 the induction of apoA-IV expression in fasting and diabetes likely involves PGC-1 alpha-mediated coactivation of HNF-4 alpha in addition to glucocorticoid-dependent actions
16893891 HNF4alpha, CREM, HNF1alpha, and C/EBPalpha have roles in transcriptional regulation of the glucose-6-phosphatase gene by cAMP/vasoactive intestinal peptide in the intestine
16883527 HNF4A gene mutation is rare in Chinese pedigrees with early and/or multiplex-onset diabetes.
16883527 Observational study of gene-disease association. (HuGE Navigator)
16882880 These results establish the importance of coactivators PGC1alpha and SRC1 for the hepatic expression of human P450s and uncover a new HNF4alpha-dependent regulatory mechanism to constitutively control the CYP1A1/2 cluster.
16873704 Observational study of gene-disease association. (HuGE Navigator)
16838170 Observational study of gene-disease association. (HuGE Navigator)
16838170 SNPs of HNF4A and their haplotypes predispose to type 2 diabetes mellitus in female subjects of the STOP-NIDDM study population.
16804065 Observational study of gene-disease association. (HuGE Navigator)
16804065 Common HNF4A variants are associated with high serum lipid levels and the metabolic syndrome.
16771709 Factors that trigger an NF-kappaB response in hepatic cells inhibit the transcriptional activity of HNF-4-dependent promoters; this inhibition could be accounted for by a decrease in DNA binding and the down-regulation of HNF-4.
16752173 Observational study of gene-disease association. (HuGE Navigator)
16731861 study identified three novel HNF4A mutations and a 3.7-Mb haplotype, including the HNF4A P2 promoter, which was linked with diabetes
16731855 Observational study of gene-disease association. (HuGE Navigator)
16731855 a rare, novel mutation that disrupts a protein binding site in the pancreatic HNF4A promoter associates with late-onset diabetes
16644680 Observational study of gene-disease association. (HuGE Navigator)
16644680 Possible existence of an a functional polymorphism in the P2 promoter region of the HNF4A gene that directly influences susceptibility to type 2 diabetes.
16584384 STAT5b and HNF4alpha exhibit bi-directional cross-talk that may augment HNF4alpha-dependent gene transcription while inhibiting STAT5b transcriptional activity via the inhibitory effects of HNF4alpha on JAK2 phosphorylation
16562587 Observational study of genotype prevalence. (HuGE Navigator)
16562587 No mutation was identified in the HNF-4alpha genes in Japanese patients with juvenile-onset (before 18 years of age) non-obese diabetes mellitus.
16523192 Observational study of gene-disease association. (HuGE Navigator)
16523192 Polymorphisms in HNF-4alpha are not associated with type 2 diabestes and prediabetic phenotypes a Polish Caucasian study group..
16502298 Mutations and phenotype heterogeneity in type 2 diabetes pedigrees.
16488887 Prox1 is a novel co-regulator of HNF4alpha that may play a key role in the regulation of bile acid synthesis and gluconeogenesis in the liver
16338932 E-cadherin controls enterocyte-specific expression of genes, such as the apoA-IV gene, through the control of hepatic nuclear factor 4alpha nuclear abundance
16223942 HNF-1alpha-HNF-4alpha functional interactions are accomplished by regulating factor promoter occupancy and defective factor-factor interactions may contribute to the maturity onset diabetes of the young phenotype.
16186411 Observational study of gene-disease association. (HuGE Navigator)
16186411 conclude that variants in hepatocyte nuclear factor 4alpha (HNF4alpha) do not appear to be major determinants for type 2 diabetes in Pima Indians but may have a minor role in genetic susceptibility
16051671 HNF-4alpha directly regulates human apoAV promoter through DR1 [a direct repeat separated by one nucleotide (nt)], and via a novel element for HNF-4alpha consisting of an inverted repeat separated by 8 nt (IR8).
16007190 Expression of wild-type HNF4alpha but not of the mutants led to reduction of proliferation and alterations of cell morphology
15983230 Observational study of gene-disease association. (HuGE Navigator)
15933212 role in transcriptional regulation of CYP2C8
15928245 relative prevalence of 3% of MODY1 (two different mutations in two families), 10% of MODY2 (seven in eight), and 36% of MODY3 (21 in 28) among Danish kindred clinically diagnosed as MODY
15919766 there is cross talk between distal CAR/PXR sites and HNF4alpha binding sites in the CYP2C9 promoter and that the HNF4alpha sites are required for maximal induction of the CYP2C9 promoter.
15831710 Cotransfection with an HNF-4alpha expression vector demonstrated a direct activation of the ALPI promoter through -94 to -82 element
15830177 Observational study of gene-disease association. (HuGE Navigator)
15830177 The HNF-4alpha clinical phenotype and beta cell dysfunction are similar to HNF-1alpha in maturity onset diabetes in the young.
15826954 analysis of amino acids involved in coactivator and ligand interactions in hepatocyte nuclear factor-4alpha
15796896 role in regulating CYP7A1
15794920 Rare loss-of-function mutations in HNF4A cause maturity-onset diabetes common noncoding variants are associated with type 2 diabetes (review)
15793260 Observational study of gene-disease association. (HuGE Navigator)
15793260 In this study, we evaluated 23 SNPs spanning 111 kb including the HNF4A gene for association with type 2 diabetes.
15752752 In the present study, we investigated the expression of HNF4alpha in beta-cells and examined its functional properties.
15735892 Observational study of gene-disease association. (HuGE Navigator)
15735892 None of the previously associated SNPs confer an increased risk for diabetes in French Caucasians.
15735891 Observational study of gene-disease association. (HuGE Navigator)
15735891 Among Ashkenazi Jewish subjects, variation near the P2 region of HNF4A is associated with type 2 diabetes in the Danish population.
15734869 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15734869 Single nucleotide polymorphisms of HNF4-alpha associated with the risk of type 2 diabetes are evaluated.
15728204 Observational study of gene-disease association. (HuGE Navigator)
15660729 Observational study of gene-disease association. (HuGE Navigator)
15651981 HNF-4alpha expression is reported here to be negatively autoregulated by HNF-4alpha1 and to be activated by dominant-negative HNF-4alpha1.
15561969 Observational study of gene-disease association. (HuGE Navigator)
15561969 Variants in both the P1 and P2 promoters of HNF4A increase risk for typical type 2 diabetes.
15547294 human microsomal triglyceride transfer protein is transcriptionally regulated by hepatocyte nuclear factor-4alpha
15520459 A comparision of gene expression patterns induced by hepatic nuclear factors, HNF6, HNF4alpha and HNF1beta, in a pancreatic beta- cell line.
15519277 HNF-4alpha is linked to late-onset type 2 diabetes.
15504983 Observational study of gene-disease association. (HuGE Navigator)
15504983 Association of the HNF4alpha P2 promoter haplotype with type 2 diabetes in a U.K. Caucasian population where there is no evidence of linkage to 20q.
15470081 HNF4alpha as a major factor for the control of UGT1A9 hepatic expression.
15358161 Data show that nitric oxide and transforming growth factor-beta1 inhibit hepatocyte nuclear factor-4alpha function in HEPG2 cells.
15337761 HNF-4 and FXR, are closely involved in MTP gene expression, and the results provide evidence for a novel interaction between bile acids and lipoprotein metabolism.
15322103 ligand-activated PXR interferes with HNF-4 signaling by targeting the common coactivator PGC-1, which underlies physiologically relevant inhibitory cross-talk between drug metabolism and cholesterol/glucose metabolism
15281001 the V199I missense mutation located in the ligand binding/dimerization domain of HNF-4alpha contributes to type 2 diabetes in a Philippine-1 family
15194767 stimulated expression of the precore RNA and the core RNA from the core promoter of both the wild-type (WT) Hepatitis B virus and the double mutant, although its effect on the former was more prominent
15123688 residues of the ligand binding pocket are critical in hepatocyte nuclear factor-4alpha
15047633 A study population of Ashkenazi Jewish origin suggests that variant(s) located near or within HNF4A increases susceptibility to type 2 diabetes.
15047632 Observational study of gene-disease association. (HuGE Navigator)
15047632 Human SNPs were identified across a 78-kb region around HNF4 alpha and evaluated in an association analysis of Ashkenazi Jewish type 2 diabetics and controls.
14988562 identifed systematically the genes occupied by the transcriptional regulators HNF1alpha, HNF4alpha, and HNF6, together with RNA polymerase II in liver and pancreatic islets; results suggest how misregulation of HNF4alpha can contribute to type 2 diabetes
14722127 HNF-4alpha has a role in regulating gluconeogenic genes along with PGC-1 and SREBP-1
14654354 HNF-4alpha represents a potential modifier of the glycerol kinase deficiency phenotype
14563941 HNF-4alpha plays an important role in the differentiation and maintenance of the matured human hepatocyte phenotype.
14551916 Observational study of gene-disease association. (HuGE Navigator)
12911579 HNF4-alpha, HNF3-beta and Sp1/Sp3 are important in regulation of prothrombin expression
12855700 hepatocyte nuclear factor-4 binds to SREBP2 to enhance sterol isomerase gene expression in hepatocytes
12829997 Hepatic expression of HNF-4 was impaired in advanced human cirrhosis and negatively correlated with WT1 mRNA levels
12701690 Transdifferentiation to the hepatocytic phenotype in hepatoid adenocarcinoma tissue of the stomach was not directly associated with HNF-4alpha expression, thus suggesting that transdifferentiation proceeds by a complicated mechanism.
12697672 HNF4 alpha isoforms originating from the P1 promoter exhibit stronger transcriptional activities and recruit coactivators more efficiently than isoforms driven by the P2 promoter.
12669197 Observational study of gene-disease association. (HuGE Navigator)
12631740 Results suggest that the transcriptional cross talk between the TGFbeta-regulated Smads 3 and 4 and hepatocyte nuclear factor-4 is mediated by specific functional domains in the two types of transcription factors.
12627330 Twenty different mutations in the HNF-4alpha, GCK and HNF-1alpha in 29 families. Three of 3, 10 of 11 and 1 of 6 of the mutations identified in HNF-4alpha, GCK and HNF-1alpha respectively, were new.
12551987 regulates transcription of hepatitis B virus
12504020 the order of recruitment of factors to the HNF-4alpha regulatory regions upon the initial activation of the gene during enterocyte differentiation
12413008 Maturity-onset diabetes of the young resulting from a novel mutation in the HNF-4alpha gene.
12235114 These findings provide genetic evidence that HNF-1alpha serves as an upstream regulator of HNF-4alpha and interacts directly with the P2 promoter in human pancreatic cells.
12220494 2.7 A X-ray crystalography results suggest that the HNF4s may be transcription factors that are constitutively bound to fatty acids
12203996 The missense mutation was located in the DNA binding domain of HNF4A, and identification of this mutation allowed for presymptomatic diagnosis in the younger generations and will improve medical follow-up of the predisposed individuals.
12133007 cooperative role with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line
12110948 These results support clinical findings that liver function can also be impaired in diabetic patients having hepatocyte nuclear factor 4alpha (HNF4alpha) mutations.
12089346 spermine significantly enhanced the interaction between HNF4alpha and full-length DRIP205 in an AF-2, NR-box-dependent manner. Spermine enhanced the interaction of DRIP205 with the VDR , but decreased the interaction of both HNF4alpha and VDR with GRIP1
12086970 MODY is caused by a translocation at chromosome 20, resulting in an upstream disruption of the gene
12083813 Observational study of gene-disease association. (HuGE Navigator)
12083813 variation in the HNF4alpha enhancer element is not a common cause of susceptibility to type 2 diabetes
12050210 mutations in maturity-onset diabetes of the young (MODY) candidate genes in 22 Spanish families.
12036449 HNF-4alpha is involved in regulating cancer cell transmigration by modulating the Fas-FasL system
11994285 HNF4 alpha activates the insulin gene directly, through a previously unrecognized cis element
11811951 Control transcription of aldehyde dehydrogenase 2
11772903 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK      1 - 70
HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR     71 - 140
RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE    141 - 210
LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ    211 - 280
IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ    281 - 350
MIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW    351 - 420
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI                    421 - 474
//

Text Mined References (391)

PMID Year Title
27011261 2016 Berberine Attenuates Development of the Hepatic Gluconeogenesis and Lipid Metabolism Disorder in Type 2 Diabetic Mice and in Palmitate-Incubated HepG2 Cells through Suppression of the HNF-4? miR122 Pathway.
26926107 2016 Synergistic action of master transcription factors controls epithelial-to-mesenchymal transition.
26743282 2015 Comparison of hepatic nuclear factor-4 expression in two- and three-dimensional culture of Wharton's jelly-derived cells exposed to hepatogenic medium.
26692490 2016 Transcriptional regulation of the human Liver X Receptor ? gene by Hepatocyte Nuclear Factor 4?.
26624507 2015 Prolyl-4-Hydroxylase 2 Potentially Contributes to Hepatocellular Carcinoma-Associated Erythrocytosis by Maintaining Hepatocyte Nuclear Factor-4? Expression.
26561320 2015 Is HNF4A a candidate to study zinc finger protein slug?
26446475 2015 Half-Life of Sulfonylureas in HNF1A and HNF4A Human MODY Patients is not Prolonged as Suggested by the Mouse Hnf1a(-/-) Model.
26302721 2015 Thyroid-Stimulating Hormone Increases HNF-4? Phosphorylation via cAMP/PKA Pathway in the Liver.
26272613 2015 Identification of the Flavonoid Luteolin as a Repressor of the Transcription Factor Hepatocyte Nuclear Factor 4?.
26241054 2015 Elevated copper impairs hepatic nuclear receptor function in Wilson's disease.
26240283 2015 Differential Effects of Hepatocyte Nuclear Factor 4? Isoforms on Tumor Growth and T-Cell Factor 4/AP-1 Interactions in Human Colorectal Cancer Cells.
26232425 2015 Pregnane X Receptor Represses HNF4? Gene to Induce Insulin-Like Growth Factor-Binding Protein IGFBP1 that Alters Morphology of and Migrates HepG2 Cells.
26216285 2015 HNF4? regulates claudin-7 protein expression during intestinal epithelial differentiation.
26213157 2015 Polymorphisms of ABCG2, ABCB1 and HNF4? are associated with Lamotrigine trough concentrations in epilepsy patients.
26100857 2015 A metabolic stress-inducible miR-34a-HNF4? pathway regulates lipid and lipoprotein metabolism.
26019449 2015 Hepatocyte nuclear factor 4? induces a tendency of differentiation and activation of rat hepatic stellate cells.
25965999 2015 G?12 overexpressed in hepatocellular carcinoma reduces microRNA-122 expression via HNF4? inactivation, which causes c-Met induction.
25819479 2015 Two patients with HNF4A-related congenital hyperinsulinism and renal tubular dysfunction: A clinical variation which includes transient hepatic dysfunction.
25808746 2016 Hepatocyte nuclear factor 4? suppresses the aggravation of colon carcinoma.
25786776 2015 Impairment of hepatic nuclear factor-4? binding to the Stim1 promoter contributes to high glucose-induced upregulation of STIM1 expression in glomerular mesangial cells.
25671620 2015 Hepatocyte nuclear factor 4 alpha polymorphisms and the metabolic syndrome in French-Canadian youth.
25616597 2015 Suppression of the pregnane X receptor during endoplasmic reticulum stress is achieved by down-regulating hepatocyte nuclear factor-4? and up-regulating liver-enriched inhibitory protein.
25592038 2015 Hepatocyte nuclear factor 4 alpha promotes the invasion, metastasis and angiogenesis of neuroblastoma cells via targeting matrix metalloproteinase 14.
25445224 2014 Competitive regulation of human intestinal ?-carotene 15,15'-monooxygenase 1 (BCMO1) gene expression by hepatocyte nuclear factor (HNF)-1? and HNF-4?.
25422324 2015 Decreased expression of hepatocyte nuclear factor 4? (Hnf4?)/microRNA-122 (miR-122) axis in hepatitis B virus-associated hepatocellular carcinoma enhances potential oncogenic GALNT10 protein activity.
25410163 2016 HNF4? is a therapeutic target that links AMPK to WNT signalling in early-stage gastric cancer.
25400315 2014 Prediabetes is associated with HNF-4 ? P2 promoter polymorphism rs1884613: a case-control study in Han Chinese population and an updated meta-analysis.
25361053 2014 Early-onset type 2 diabetes mellitus is associated to HNF4A T130I polymorphism in families of central Spain.
25356900 2015 Combined effects of hepatocyte nuclear factor 4? and constitutive androstane receptor on stable warfarin doses.
25355887 2015 The hepatitis B virus (HBV) HBx protein activates AKT to simultaneously regulate HBV replication and hepatocyte survival.
25242412 2014 CXCR7 correlates with the differentiation of hepatocellular carcinoma and suppresses HNF4? expression through the ERK pathway.
25209865 2014 Transcriptional regulation of urate transportosome member SLC2A9 by nuclear receptor HNF4?.
25056436 2014 HNF-4? regulates expression of human ornithin carbamoyltransferase through interaction with two positive cis-acting regulatory elements located in the proximal promoter.
24828613 2014 Adiponectin upregulates SHBG production: molecular mechanisms and potential implications.
24819304 2014 Hepatocyte nuclear factor 4? (HNF4?) in coordination with retinoic acid receptors increases all-trans-retinoic acid-dependent CYP26A1 gene expression in HepG2 human hepatocytes.
24752868 2014 Hepatocyte nuclear factor 4?-nuclear factor-?B feedback circuit modulates liver cancer progression.
24713057 2014 Pulsatile exposure to simulated reflux leads to changes in gene expression in a 3D model of oesophageal mucosa.
24711169 2014 HNF4A immunohistochemistry facilitates distinction between primary and metastatic breast and gastric carcinoma.
24619225 2014 The pro-apoptotic role of the regulatory feedback loop between miR-124 and PKM1/HNF4? in colorectal cancer cells.
24559927 2014 Roles of HNF1? and HNF4? in pancreatic ?-cells: lessons from a monogenic form of diabetes (MODY).
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24463962 2014 Alternative human liver transcripts of TCF7L2 bind to the gluconeogenesis regulator HNF4? at the protein level.
24448600 2014 Thr130Ile polymorphism of HNF4A gene is associated with gestational diabetes mellitus in Mexican population.
24399729 2013 Glucocorticoid receptor regulates organic cation transporter 1 (OCT1, SLC22A1) expression via HNF4? upregulation in primary human hepatocytes.
24384557 2014 Pregnane X receptor and hepatocyte nuclear factor 4? polymorphisms are cooperatively associated with carbamazepine autoinduction.
24323243 2014 De novo mutations of GCK, HNF1A and HNF4A may be more frequent in MODY than previously assumed.
24299156 2014 HNF4A mutation: switch from hyperinsulinaemic hypoglycaemia to maturity-onset diabetes of the young, and incretin response.
24285859 2014 The HNF4A R76W mutation causes atypical dominant Fanconi syndrome in addition to a ? cell phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24177414 2013 HNF4? contributes to glucose formation in aged rat hepatocytes.
24101726 2013 A double-negative feedback loop between Wnt-?-catenin signaling and HNF4? regulates epithelial-mesenchymal transition in hepatocellular carcinoma.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24059685 2013 The role of hepatocyte nuclear factor 4alpha in metastatic tumor formation of hepatocellular carcinoma and its close relationship with the mesenchymal-epithelial transition markers.
24000795 2013 Genomic characterization of remission in juvenile idiopathic arthritis.
23981200 2014 Prognostic value of hepatocyte nuclear factors 4? and 1? identified by tissue microarray in resectable hepatocellular carcinoma.
23878349 2013 Maturity onset diabetes of the young: identification and diagnosis.
23874642 2013 Characterization of the mitochondrial localization of the nuclear receptor SHP and regulation of its subcellular distribution by interaction with Bcl2 and HNF4?.
23803251 2013 Effects of hepatocyte nuclear factor-1A and -4A on pancreatic stone protein/regenerating protein and C-reactive protein gene expression: implications for maturity-onset diabetes of the young.
23775631 2013 Hepatocyte nuclear factor-4? reverses malignancy of hepatocellular carcinoma through regulating miR-134 in the DLK1-DIO3 region.
23714368 2013 FOXO6 promotes gastric cancer cell tumorigenicity via upregulation of C-myc.
23714182 2013 Transcription of the human microsomal epoxide hydrolase gene (EPHX1) is regulated by an HNF-4?/CAR/RXR/PSF complex.
23652628 2013 Detection and characterization of two novel mutations in the HNF4A gene in maturity-onset diabetes of the young type 1 in two Japanese families.
23628799 2013 Hepatic nuclear factor 4? positively regulates complement C3 expression and does not interfere with TNF?-mediated stimulation of C3 expression in HepG2 cells.
23551881 2013 Digenic heterozygous HNF1A and HNF4A mutations in two siblings with childhood-onset diabetes.
23354620 2013 Association of genes involved in bile acid synthesis with the progression of primary biliary cirrhosis in Japanese patients.
23348805 2013 Mutations in the genes encoding the transcription factors hepatocyte nuclear factor 1 alpha and 4 alpha in maturity-onset diabetes of the young and hyperinsulinemic hypoglycemia.
23307400 2013 Epigenetic control of HNF-4? in colon carcinoma cells affects MUC4 expression and malignancy.
23292115 2013 Effect of HNF4? genetic polymorphism G60D on the pharmacokinetics of CYP2D6 substrate tolterodine in healthy Korean individuals.
23268925 2013 Genetic variations of NR2A1 in Asian populations: implications in pharmacogenetics studies.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23108025 2013 HNF4? as a marker for invasive mucinous adenocarcinoma of the lung.
23052196 2013 Inhibition of hepatocyte nuclear factor 1 and 4 alpha (HNF1? and HNF4?) as a mechanism of arsenic carcinogenesis.
23038264 2012 Nuclear receptors HNF4? and LRH-1 cooperate in regulating Cyp7a1 in vivo.
22960426 2013 TGF? overrides HNF4? tumor suppressing activity through GSK3? inactivation: implication for hepatocellular carcinoma gene therapy.
22952853 2012 MED25 is a mediator component of HNF4?-driven transcription leading to insulin secretion in pancreatic beta-cells.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22914433 2012 Association between genetic variants in the HNF4A gene and childhood-onset Crohn's disease.
22902540 2012 IL1? down-regulation of sex hormone-binding globulin production by decreasing HNF-4? via MEK-1/2 and JNK MAPK pathways.
22802087 2012 Novel presentations of congenital hyperinsulinism due to mutations in the MODY genes: HNF1A and HNF4A.
22791717 2012 Mucroporin-M1 inhibits hepatitis B virus replication by activating the mitogen-activated protein kinase (MAPK) pathway and down-regulating HNF4? in vitro and in vivo.
22628013 2012 Lethal factor VII deficiency due to novel mutations in the F7 promoter: functional analysis reveals disruption of HNF4 binding site.
22505616 2012 SUMOylation of HNF4? regulates protein stability and hepatocyte function.
22432108 2012 Systematic assessment of etiology in adults with a clinical diagnosis of young-onset type 2 diabetes is a successful strategy for identifying maturity-onset diabetes of the young.
22383578 2012 Identification of a binding motif specific to HNF4 by comparative analysis of multiple nuclear receptors.
22357705 2012 NR2F1 disrupts synergistic activation of the MTTP gene transcription by HNF-4? and HNF-1?.
22333269 2012 Lower expression of HNF4? and PGC1? might impair rifampicin-mediated CYP3A4 induction under conditions where PXR is overexpressed in human fetal liver cells.
22308320 2012 Src tyrosine kinase phosphorylation of nuclear receptor HNF4? correlates with isoform-specific loss of HNF4? in human colon cancer.
22282358 2012 HNF4? increases liver-specific human ATP-binding cassette transporter A1 expression and cholesterol efflux to apolipoprotein A-I in response to cholesterol depletion.
22240483 2012 Estrogen receptor ? represses transcription of HBV genes via interaction with hepatocyte nuclear factor 4?.
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
22155889 2012 Two novel cis-elements involved in hepatocyte nuclear factor 4? regulation of acyl-coenzyme A:cholesterol acyltransferase 2 expression.
22153071 2011 An HNF4?-miRNA inflammatory feedback circuit regulates hepatocellular oncogenesis.
22140441 2011 A systematic analysis of the 3'UTR of HNF4A mRNA reveals an interplay of regulatory elements including miRNA target sites.
22068426 2012 Efficient generation of functional hepatocytes from human embryonic stem cells and induced pluripotent stem cells by HNF4? transduction.
22060211 2012 Comprehensive molecular analysis of Japanese patients with pediatric-onset MODY-type diabetes mellitus.
21983932 2012 Association of hepatocyte nuclear factor 4 alpha polymorphisms with type 2 diabetes with or without metabolic syndrome in Malaysia.
21922456 2012 Monogenic diabetes in a family with 2 unknown HNF-4A gene mutations.
21874001 2011 Genome-wide association study in individuals of South Asian ancestry identifies six new type 2 diabetes susceptibility loci.
21852396 2011 HNF4A is essential for specification of hepatic progenitors from human pluripotent stem cells.
21831733 2011 Association of FCGR2A, JAK2 or HNF4A variants with ulcerative colitis in Koreans.
21814221 2011 Association of variants in genes involved in pancreatic ?-cell development and function with type 2 diabetes in North Indians.
21799848 2011 The hepatitis E virus ORF3 protein regulates the expression of liver-specific genes by modulating localization of hepatocyte nuclear factor 4.
21760481 2011 Mutation in the factor VII hepatocyte nuclear factor 4?-binding site contributes to factor VII deficiency.
21744425 2011 HNF4? and CDH1 are associated with ulcerative colitis in a Dutch cohort.
21733563 2011 Hepatocyte nuclear factor 4A expression discriminates gastric involvement by metastatic breast carcinomas from primary gastric adenocarcinomas.
21725089 2011 Diurnal regulation of the early growth response 1 (Egr-1) protein expression by hepatocyte nuclear factor 4alpha (HNF4alpha) and small heterodimer partner (SHP) cross-talk in liver fibrosis.
21708125 2011 Multiple post-translational modifications in hepatocyte nuclear factor 4?.
21683639 2011 Identification of HNF1A-MODY and HNF4A-MODY in Irish families: phenotypic characteristics and therapeutic implications.
21646355 2011 Cell type-specific target selection by combinatorial binding of Smad2/3 proteins and hepatocyte nuclear factor 4alpha in HepG2 cells.
21633728 2011 Hepatocyte nuclear factor 4 alpha P2 promoter variants associate with insulin resistance.
21618351 2011 Expression of HNF4? is downregulated in patients with active ulcerative colitis (UC) compared to UC patients in remission and healthy controls.
21532585 2011 PKA-dependent regulation of the histone lysine demethylase complex PHF2-ARID5B.
21494118 2011 Hepatocyte nuclear factor (HNF) 4? expression distinguishes ampullary cancer subtypes and prognosis after resection.
21493011 2011 Primary hepatoid adenocarcinoma of the uterine corpus: A case report with immunohistochemical study for expression of liver-enriched nuclear factors.
21442235 2011 Association analyses between the genetic polymorphisms of HNF4A and FOXO1 genes and Chinese Han patients with type 2 diabetes.
21384409 2011 The stable repression of mesenchymal program is required for hepatocyte identity: a novel role for hepatocyte nuclear factor 4?.
21352552 2011 Expression profile analysis of the inflammatory response regulated by hepatocyte nuclear factor 4?.
21323639 2011 Probing the effect of MODY mutations near the co-activator-binding pocket of HNF4?.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21062980 2010 Hepatocyte nuclear factor-4alpha promotes gut neoplasia in mice and protects against the production of reactive oxygen species.
21062274 2011 Association of novel variants in the hepatocyte nuclear factor 4A gene with maturity onset diabetes of the young and early onset type 2 diabetes.
21047794 2011 Proteomic analysis of native hepatocyte nuclear factor-4? (HNF4?) isoforms, phosphorylation status, and interactive cofactors.
20976847 2010 HNF-4? determines hepatic differentiation of human mesenchymal stem cells from bone marrow.
20931292 2010 Congenital hyperinsulinism due to mutations in HNF4A and HADH.
20878384 2011 A role for coding functional variants in HNF4A in type 2 diabetes susceptibility.
20871093 2010 Modification in oxidative stress, inflammation, and lipoprotein assembly in response to hepatocyte nuclear factor 4alpha knockdown in intestinal epithelial cells.
20863361 2010 Disease progression and search for monogenic diabetes among children with new onset type 1 diabetes negative for ICA, GAD- and IA-2 Antibodies.
20735474 2010 Hepatocyte nuclear factor-4? interacts with other hepatocyte nuclear factors in regulating transthyretin gene expression.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20705777 2010 Double heterozygous mutations involving both HNF1A/MODY3 and HNF4A/MODY1 genes: a case report.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20684663 2010 A nuclear receptor, hepatocyte nuclear factor 4, differently contributes to the human and mouse angiotensinogen promoter activities.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20670916 2010 cAMP-mediated regulation of HNF-4alpha depends on the level of coactivator PGC-1alpha.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622021 2010 CCAAT/enhancer-binding protein alpha (C/EBPalpha) and hepatocyte nuclear factor 4alpha (HNF4alpha) synergistically cooperate with constitutive androstane receptor to transactivate the human cytochrome P450 2B6 (CYP2B6) gene: application to the development of a metabolically competent human hepatic cell model.
20576917 2010 Inactivation of hepatocyte nuclear factor-4{alpha} mediates alcohol-induced downregulation of intestinal tight junction proteins.
20558840 2010 Variants in hepatocyte nuclear factor 4alpha gene promoter region and type 2 diabetes risk in Chinese.
20546279 2010 Novel monogenic diabetes mutations in the P2 promoter of the HNF4A gene are associated with impaired function in vitro.
20463007 2010 The ERK1/2-hepatocyte nuclear factor 4alpha axis regulates human ABCC6 gene expression in hepatocytes.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20361036 2010 Gene-gene interactions lead to higher risk for development of type 2 diabetes in an Ashkenazi Jewish population.
20308432 2010 Association analysis of 33 lipoprotein candidate genes in multi-generational families of African ancestry.
20167659 2010 DGAT1 participates in the effect of HNF4A on hepatic secretion of triglyceride-rich lipoproteins.
20164212 2010 Diazoxide-responsive hyperinsulinemic hypoglycemia caused by HNF4A gene mutations.
20158877 2010 Analysis of deep sequencing microRNA expression profile from human embryonic stem cells derived mesenchymal stem cells reveals possible role of let-7 microRNA family in downstream targeting of hepatic nuclear factor 4 alpha.
20086032 2010 Hepatocyte nuclear factor 4{alpha} regulates rifampicin-mediated induction of CYP2C genes in primary cultures of human hepatocytes.
20079163 2009 Effect of genetic variants in KCNJ11, ABCC8, PPARG and HNF4A loci on the susceptibility of type 2 diabetes in Chinese Han population.
20003313 2009 Mutations in the coding regions of the hepatocyte nuclear factor 4 alpha in Iranian families with maturity onset diabetes of the young.
19966299 2010 A beta-catenin/TCF-coordinated chromatin loop at MYC integrates 5' and 3' Wnt responsive enhancers.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19934400 2010 Genetic predictors of interindividual variability in hepatic CYP3A4 expression.
19924231 2009 Species-specific differences in the expression of the HNF1A, HNF1B and HNF4A genes.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19846556 2009 Multiple binding modes between HNF4alpha and the LXXLL motifs of PGC-1alpha lead to full activation.
19805548 2009 Proteomics reveals a physical and functional link between hepatocyte nuclear factor 4alpha and transcription factor IID.
19761587 2009 Mapping of HNF4alpha target genes in intestinal epithelial cells.
19748811 2010 Influence of hepatocyte nuclear factor 4alpha (HNF4alpha) gene variants on the risk of type 2 diabetes: a meta-analysis in 49,577 individuals.
19651776 2009 DAX-1 acts as a novel corepressor of orphan nuclear receptor HNF4alpha and negatively regulates gluconeogenic enzyme gene expression.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19575803 2009 Expression of HNF4alpha in the human and rat choroid plexus: implications for drug transport across the blood-cerebrospinal-fluid (CSF) barrier.
19563409 2009 Immunohistochemical staining for P1 and P2 promoter-driven hepatocyte nuclear factor-4alpha may complement mucin phenotype of differentiated-type early gastric carcinoma.
19549071 2009 Functional dissection of the alpha-synuclein promoter: transcriptional regulation by ZSCAN21 and ZNF219.
19467232 2009 Early growth response 1 loops the CYP2B6 promoter for synergistic activation by the distal and proximal nuclear receptors CAR and HNF4alpha.
19454287 2009 Convergence of Wnt signaling on the HNF4alpha-driven transcription in controlling liver zonation.
19435525 2009 TCF/beta-catenin plays an important role in HCCR-1 oncogene expression.
19406499 2009 Interaction between HNF4A polymorphisms and physical activity in relation to type 2 diabetes-related traits: results from the Quebec Family Study.
19389810 2009 Fasting-induced hepatic production of DHEA is regulated by PGC-1alpha, ERRalpha, and HNF4alpha.
19353766 2009 Novel P2 promoter-derived HNF4alpha isoforms with different N-terminus generated by alternate exon insertion.
19336534 2009 Thyroid hormones act indirectly to increase sex hormone-binding globulin production by liver via hepatocyte nuclear factor-4alpha.
19302415 2009 The correlation of hepatocyte nuclear factor 4 alpha and 3 beta with hepatitis B virus replication in the liver of chronic hepatitis B patients.
19228884 2009 Hepatocyte nuclear factor-4alpha and bile acids regulate human concentrative nucleoside transporter-1 gene expression.
19228875 2009 A-beta-subtype of ketosis-prone diabetes is not predominantly a monogenic diabetic syndrome.
19188435 2009 Functional targets of the monogenic diabetes transcription factors HNF-1alpha and HNF-4alpha are highly conserved between mice and humans.
19179483 2009 Down-regulation of hepatic HNF4alpha gene expression during hyperinsulinemia via SREBPs.
19154258 2009 Protein expression of nuclear receptors in human and murine tissues.
19147806 2009 Hepatocyte nuclear factor-4alpha regulates human cellular retinol-binding protein type II gene expression in intestinal cells.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19048623 2009 Inhibition of colorectal cancer by targeting hepatocyte nuclear factor-4alpha.
18988528 [Hepatocyte nuclear factor 4 (HNF4) in epithelial development and carcinogenesis].
18844932 2008 Expression of hepatocyte nuclear factor 4 alpha in primary ovarian mucinous tumors.
18829458 2008 Structural basis of natural promoter recognition by a unique nuclear receptor, HNF4alpha. Diabetes gene product.
18811724 2009 Mutations of maturity-onset diabetes of the young (MODY) genes in Thais with early-onset type 2 diabetes mellitus.
18805788 2008 A combination of HNF-4 and Foxo1 is required for reciprocal transcriptional regulation of glucokinase and glucose-6-phosphatase genes in response to fasting and feeding.
18765665 2008 Molecular cloning and characterization of the human PED/PEA-15 gene promoter reveal antagonistic regulation by hepatocyte nuclear factor 4alpha and chicken ovalbumin upstream promoter transcription factor II.
18728231 2008 Population-specific risk of type 2 diabetes conferred by HNF4A P2 promoter variants: a lesson for replication studies.
18666237 2008 Genetic polymorphism of hepatocyte nuclear factor-4alpha influences human cytochrome P450 2D6 activity.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18654034 2008 A common P2 promoter polymorphism of the hepatocyte nuclear factor-4alpha gene is associated with insulin secretion in non-obese Japanese with type 2 diabetes.
18602983 2008 Heterogeneity in gene loci associated with type 2 diabetes on human chromosome 20q13.1.
18561282 2008 Expression of HNF4alpha variants in pancreatic islets and Ins-1 beta cells.
18552123 2008 Nuclear receptor coactivator 6 mediates the synergistic activation of human cytochrome P-450 2C9 by the constitutive androstane receptor and hepatic nuclear factor-4alpha.
18513302 2008 Can complement factors 5 and 8 and transthyretin be used as biomarkers for MODY 1 (HNF4A-MODY) and MODY 3 (HNF1A-MODY)?
18513187 2008 Down-regulation of hepatic nuclear factor 4alpha on expression of human hepatic stimulator substance via its action on the proximal promoter in HepG2 cells.
18498634 2008 The genetic susceptibility to type 2 diabetes may be modulated by obesity status: implications for association studies.
18426912 2008 Hepatocyte nuclear factor 4alpha contributes to thyroid hormone homeostasis by cooperatively regulating the type 1 iodothyronine deiodinase gene with GATA4 and Kruppel-like transcription factor 9.
18395097 2008 EPS15R, TASP1, and PRPF3 are novel disease candidate genes targeted by HNF4alpha splice variants in hepatocellular carcinomas.
18391435 2008 Crystallization of hepatocyte nuclear factor 4 alpha (HNF4 alpha) in complex with the HNF1 alpha promoter element.
18356407 2008 The diabetic phenotype in HNF4A mutation carriers is moderated by the expression of HNF4A isoforms from the P1 promoter during fetal development.
18346225 2008 A concerted action of HNF4alpha and HNF1alpha links hepatitis B virus replication to hepatocyte differentiation.
18332101 2008 Common variants in maturity-onset diabetes of the young genes and future risk of type 2 diabetes.
18305375 2008 Involvement of hepatocyte nuclear factor 4 alpha in transcriptional regulation of the human pregnane X receptor gene in the human liver.
18305369 2008 Regulation of hepatocyte nuclear factor 4 alpha-mediated transcription.
18268044 2008 Persistent hyperinsulinemic hypoglycemia and maturity-onset diabetes of the young due to heterozygous HNF4A mutations.
18234786 2008 Differential inhibition of nuclear hormone receptor-dependent hepatitis B virus replication by the small heterodimer partner.
18199540 2008 Regulation of vascular endothelial growth factor D by orphan receptors hepatocyte nuclear factor-4 alpha and chicken ovalbumin upstream promoter transcription factors 1 and 2.
18184923 2008 HNF4 alpha and the Ca-channel TRPC1 are novel disease candidate genes in diabetic nephropathy.
18163890 2008 HNF4 alpha orchestrates a set of 14 genes to down-regulate cell proliferation in kidney cells.
18162503 2008 Evidence of interaction between PPARG2 and HNF4A contributing to variation in insulin sensitivity in Mexican Americans.
18056193 2007 Lack of association of single-nucleotide polymorphisms in pregnane X receptor, hepatic nuclear factor 4alpha, and constitutive androstane receptor with docetaxel pharmacokinetics.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18028455 2008 High frequency of T130I mutation of HNF4A gene in Mexican patients with early-onset type 2 diabetes.
17992261 2007 Monosaccharide-induced lipogenesis regulates the human hepatic sex hormone-binding globulin gene.
17991764 2008 Expression of the hepatic specific V1 messenger ribonucleic acid of the human growth hormone receptor gene is regulated by hepatic nuclear factor (HNF)-4alpha2 and HNF-4alpha8.
17978169 2008 Dexamethasone-mediated up-regulation of human CYP2A6 involves the glucocorticoid receptor and increased binding of hepatic nuclear factor 4 alpha to the proximal promoter.
17965524 2007 Hepatocyte nuclear factor 1 alpha and 4 alpha are factors involved in interindividual variability in the expression of UGT1A6 and UGT1A9 but not UGT1A1, UGT1A3 and UGT1A4 mRNA in human livers.
17958743 2007 Regulation of human protein Z gene expression by liver-enriched transcription factor HNF-4alpha and ubiquitous factor Sp1.
17932483 2007 Cited2, a coactivator of HNF4alpha, is essential for liver development.
17923767 2007 Distinct roles of HNF1beta, HNF1alpha, and HNF4alpha in regulating pancreas development, beta-cell function and growth.
17920062 2007 A novel role of transforming growth factor beta1 in transcriptional repression of human cholesterol 7alpha-hydroxylase gene.
17894829 2007 Gene-gene interactions between HNF4A and KCNJ11 in predicting Type 2 diabetes in women.
17891372 2007 Macrosomia and neonatal hypoglycaemia in RW pedigree subjects with a mutation (Q268X) in the gene encoding hepatocyte nuclear factor 4alpha (HNF4A).
17885207 2008 Nuclear receptor hepatocyte nuclear factor 4alpha1 competes with oncoprotein c-Myc for control of the p21/WAF1 promoter.
17876342 2008 PXR, CAR and HNF4alpha genotypes and their association with pharmacokinetics and pharmacodynamics of docetaxel and doxorubicin in Asian patients.
17827783 2007 Role of human hepatocyte nuclear factor 4alpha in the expression of drug-metabolizing enzymes and transporters in human hepatocytes assessed by use of small interfering RNA.
17827402 2007 Studies in 3,523 Norwegians and meta-analysis in 11,571 subjects indicate that variants in the hepatocyte nuclear factor 4 alpha (HNF4A) P2 region are associated with type 2 diabetes in Scandinavians.
17805472 2007 Association of genetic variations near P2 promoter of the hepatocyte nuclear factor-4alpha gene and insulin secretion index in Thais.
17785436 2007 E-cadherin is required for caveolin-1-mediated down-regulation of the inhibitor of apoptosis protein survivin via reduced beta-catenin-Tcf/Lef-dependent transcription.
17764444 2008 The far and distal enhancers in the CYP3A4 gene co-ordinate the proximal promoter in responding similarly to the pregnane X receptor but differentially to hepatocyte nuclear factor-4alpha.
17601994 2007 Variants of the transcription factor 7-like 2 (TCF7L2) gene are associated with type 2 diabetes in an African-American population enriched for nephropathy.
17576804 2007 Expression of constitutive androstane receptor, hepatic nuclear factor 4 alpha, and P450 oxidoreductase genes determines interindividual variability in basal expression and activity of a broad scope of xenobiotic metabolism genes in the human liver.
17574576 2007 Effects of hepatocyte nuclear factor-4alpha on the regulation of the hepatic acute phase response.
17563455 2007 HNF4A genetic variants: role in diabetes.
17466274 2007 Search of type 2 diabetes susceptibility gene on chromosome 20q.
17464991 2007 Differential regulation of constitutive androstane receptor expression by hepatocyte nuclear factor4alpha isoforms.
17407387 2007 Macrosomia and hyperinsulinaemic hypoglycaemia in patients with heterozygous mutations in the HNF4A gene.
17403900 2007 Cooperative interaction between hepatocyte nuclear factor 4 alpha and GATA transcription factors regulates ATP-binding cassette sterol transporters ABCG5 and ABCG8.
17393984 2006 The expression of hepatocyte nuclear factor-4alpha, a developmental regulator of visceral endoderm, correlates with the intestinal phenotype of gastric adenocarcinomas.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344191 2007 Hepatocyte nuclear factor-4{alpha} regulates the human organic anion transporter 1 gene in the kidney.
17343826 2007 The human intestinal fatty acid binding protein (hFABP2) gene is regulated by HNF-4alpha.
17327436 2007 Evaluation of common variants in the six known maturity-onset diabetes of the young (MODY) genes for association with type 2 diabetes.
17317687 2007 Characterization of the PC4 binding domain and its interactions with HNF4alpha.
17300672 2007 Downregulated P1 promoter-driven hepatocyte nuclear factor-4alpha expression in human colorectal carcinoma is a new prognostic factor against liver metastasis.
17291450 2007 beta-Catenin/TCF/LEF regulate expression of the short form human Cripto-1.
17264800 2007 Hepatocyte nuclear factor1 transcription factors are essential for the UDP-glucuronosyltransferase 1A9 promoter response to hepatocyte nuclear factor 4alpha.
17259399 2007 P2 promoter variants of the hepatocyte nuclear factor 4alpha gene are associated with type 2 diabetes in Mexican Americans.
17052457 2006 Two functional modes of a nuclear receptor-recruited arginine methyltransferase in transcriptional activation.
17022998 2006 Hepatocyte nuclear factor 4 alpha ligand binding and F domains mediate interaction and transcriptional synergy with the pancreatic islet LIM HD transcription factor Isl1.
17007050 2006 Hepatogenic differentiation of human mesenchymal stem cells from adipose tissue in comparison with bone marrow mesenchymal stem cells.
16980607 2006 Mitogen-activated protein kinase-mediated disruption of enhancer-promoter communication inhibits hepatocyte nuclear factor 4alpha expression.
16978381 2006 Large-scale study of the -232C > G polymorphism of PCK1 in Type 2 diabetes.
16955255 2006 Association study on chromosome 20q11.21-13.13 locus and its contribution to type 2 diabetes susceptibility in Japanese.
16946562 2006 Novel genetic variations and haplotypes of hepatocyte nuclear factor 4alpha (HNF4A) found in Japanese type II diabetic patients.
16936201 2006 Common variants in maturity-onset diabetes of the young genes contribute to risk of type 2 diabetes in Finns.
16929032 2006 Apolipoprotein A-IV is regulated by nutritional and metabolic stress: involvement of glucocorticoids, HNF-4 alpha, and PGC-1 alpha.
16893891 2006 Transcriptional regulation of the glucose-6-phosphatase gene by cAMP/vasoactive intestinal peptide in the intestine. Role of HNF4alpha, CREM, HNF1alpha, and C/EBPalpha.
16883527 2006 [Scanning the HNF4A gene mutation from Chinese pedigrees with early- and/or multiple-onset diabetes].
16882880 2006 Transcriptional activation of CYP2C9, CYP1A1, and CYP1A2 by hepatocyte nuclear factor 4alpha requires coactivators peroxisomal proliferator activated receptor-gamma coactivator 1alpha and steroid receptor coactivator 1.
16873704 2006 Association studies of variants in the genes involved in pancreatic beta-cell function in type 2 diabetes in Japanese subjects.
16838170 2006 Single nucleotide polymorphisms of the HNF4alpha gene are associated with the conversion to type 2 diabetes mellitus: the STOP-NIDDM trial.
16804065 2006 Common hepatic nuclear factor-4alpha variants are associated with high serum lipid levels and the metabolic syndrome.
16771709 2006 Inhibition of hepatocyte nuclear factor 4 transcriptional activity by the nuclear factor kappaB pathway.
16752173 2006 Common variants in MODY genes increase the risk of gestational diabetes mellitus.
16731861 2006 A hepatocyte nuclear factor-4 alpha gene (HNF4A) P2 promoter haplotype linked with late-onset diabetes: studies of HNF4A variants in the Norwegian MODY registry.
16731855 2006 A novel -192c/g mutation in the proximal P2 promoter of the hepatocyte nuclear factor-4 alpha gene (HNF4A) associates with late-onset diabetes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16644680 2006 Hepatocyte nuclear factor-4alpha P2 promoter haplotypes are associated with type 2 diabetes in the Japanese population.
16584384 2006 Signalling cross-talk between hepatocyte nuclear factor 4alpha and growth-hormone-activated STAT5b.
16562587 2006 Molecular genetic analysis of MODY candidate genes in Japanese patients with non-obese juvenile onset diabetes mellitus.
16523192 2006 Polymorphisms in the gene encoding hepatocyte nuclear factor-4alpha and susceptibility to type 2 diabetes in a Polish population.
16502298 2006 Phenotypic heterogeneity between different mutations of MODY subtypes and within MODY pedigrees.
16488887 2006 A Prospero-related homeodomain protein is a novel co-regulator of hepatocyte nuclear factor 4alpha that regulates the cholesterol 7alpha-hydroxylase gene.
16338932 2006 E-cadherin-dependent transcriptional control of apolipoprotein A-IV gene expression in intestinal epithelial cells: a role for the hepatic nuclear factor 4.
16223942 2006 Mechanisms of mutual functional interactions between HNF-4alpha and HNF-1alpha revealed by mutations that cause maturity onset diabetes of the young.
16186411 2005 Variants in hepatocyte nuclear factor 4alpha are modestly associated with type 2 diabetes in Pima Indians.
16051671 2005 Hepatocyte nuclear factor-4alpha regulates the human apolipoprotein AV gene: identification of a novel response element and involvement in the control by peroxisome proliferator-activated receptor-gamma coactivator-1alpha, AMP-activated protein kinase, and mitogen-activated protein kinase pathway.
16007190 2005 HNF4alpha reduces proliferation of kidney cells and affects genes deregulated in renal cell carcinoma.
15983230 2005 Polymorphisms in the SLC2A2 (GLUT2) gene are associated with the conversion from impaired glucose tolerance to type 2 diabetes: the Finnish Diabetes Prevention Study.
15933212 2005 Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha.
15928245 2005 Half of clinically defined maturity-onset diabetes of the young patients in Denmark do not have mutations in HNF4A, GCK, and TCF1.
15919766 2005 The nuclear receptors constitutive androstane receptor and pregnane X receptor cross-talk with hepatic nuclear factor 4alpha to synergistically activate the human CYP2C9 promoter.
15831710 2005 Differentiation-dependent activation of the human intestinal alkaline phosphatase promoter by HNF-4 in intestinal cells.
15830177 2005 Molecular genetics and phenotypic characteristics of MODY caused by hepatocyte nuclear factor 4alpha mutations in a large European collection.
15826954 2005 Distinct amino acid residues may be involved in coactivator and ligand interactions in hepatocyte nuclear factor-4alpha.
15796896 2005 Feedback regulation of bile acid synthesis in human liver: importance of HNF-4alpha for regulation of CYP7A1.
15794920 2005 The role of HNF4A variants in the risk of type 2 diabetes.
15793260 2005 Genetic analysis of HNF4A polymorphisms in Caucasian-American type 2 diabetes.
15752752 2005 Functional characterization of the HNF4alpha isoform (HNF4alpha8) expressed in pancreatic beta-cells.
15735892 2005 Effect of common polymorphisms in the HNF4alpha promoter on susceptibility to type 2 diabetes in the French Caucasian population.
15735891 2005 Variation near the hepatocyte nuclear factor (HNF)-4alpha gene associates with type 2 diabetes in the Danish population.
15734869 2005 Association testing of variants in the hepatocyte nuclear factor 4alpha gene with risk of type 2 diabetes in 7,883 people.
15728204 2005 The functional Thr130Ile and Val255Met polymorphisms of the hepatocyte nuclear factor-4alpha (HNF4A): gene associations with type 2 diabetes or altered beta-cell function among Danes.
15660729 2005 Clinical characteristics, beta-cell function, HLA class II and mutations in MODY genes in non-paediatric subjects with Type 1 diabetes without pancreatic autoantibodies.
15651981 2005 Negative autoregulation of HNF-4alpha gene expression by HNF-4alpha1.
15574752 2004 Role of a BCL9-related beta-catenin-binding protein, B9L, in tumorigenesis induced by aberrant activation of Wnt signaling.
15561969 2004 Polymorphisms in both promoters of hepatocyte nuclear factor 4-alpha are associated with type 2 diabetes in the Amish.
15547294 2005 Transcriptional regulation of human microsomal triglyceride transfer protein by hepatocyte nuclear factor-4alpha.
15520459 2004 Pattern of genes influenced by conditional expression of the transcription factors HNF6, HNF4alpha and HNF1beta in a pancreatic beta-cell line.
15519277 2004 HNF-4alpha: from MODY to late-onset type 2 diabetes.
15504983 2004 Common variants of the hepatocyte nuclear factor-4alpha P2 promoter are associated with type 2 diabetes in the U.K. population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470081 2005 Hepatic expression of the UGT1A9 gene is governed by hepatocyte nuclear factor 4alpha.
15358161 2004 Nitric oxide and TGF-beta1 inhibit HNF-4alpha function in HEPG2 cells.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15337761 2004 Bile acid reduces the secretion of very low density lipoprotein by repressing microsomal triglyceride transfer protein gene expression mediated by hepatocyte nuclear factor-4.
15322103 2004 Ligand-activated pregnane X receptor interferes with HNF-4 signaling by targeting a common coactivator PGC-1alpha. Functional implications in hepatic cholesterol and glucose metabolism.
15281001 2004 Triple genetic variation in the HNF-4alpha gene is associated with early-onset type 2 diabetes mellitus in a philippino family.
15194767 2004 Regulation of hepatitis B virus core promoter by transcription factors HNF1 and HNF4 and the viral X protein.
15123688 2004 Critical role of residues defining the ligand binding pocket in hepatocyte nuclear factor-4alpha.
15047633 2004 Genetic variation near the hepatocyte nuclear factor-4 alpha gene predicts susceptibility to type 2 diabetes.
15047632 2004 A common polymorphism in the upstream promoter region of the hepatocyte nuclear factor-4 alpha gene on chromosome 20q is associated with type 2 diabetes and appears to contribute to the evidence for linkage in an ashkenazi jewish population.
14988562 2004 Control of pancreas and liver gene expression by HNF transcription factors.
14982928 2004 Structural basis for HNF-4alpha activation by ligand and coactivator binding.
14722127 2004 SREBP-1 interacts with hepatocyte nuclear factor-4 alpha and interferes with PGC-1 recruitment to suppress hepatic gluconeogenic genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654354 2003 Characterization of the human glycerol kinase promoter: identification of a functional HNF-4alpha binding site and evidence for transcriptional activation.
14563941 2003 A crucial role of hepatocyte nuclear factor-4 expression in the differentiation of human ductular hepatocytes.
14551916 2003 Candidate gene association study in type 2 diabetes indicates a role for genes involved in beta-cell function as well as insulin action.
12911579 2003 Functional characterization of transcription factor binding sites for HNF1-alpha, HNF3-beta (FOXA2), HNF4-alpha, Sp1 and Sp3 in the human prothrombin gene enhancer.
12855700 2003 Sterol regulatory element-binding protein-2 interacts with hepatocyte nuclear factor-4 to enhance sterol isomerase gene expression in hepatocytes.
12829997 2003 Expression of Wilms' tumor suppressor in the liver with cirrhosis: relation to hepatocyte nuclear factor 4 and hepatocellular function.
12740371 2003 AMP-activated protein kinase regulates HNF4alpha transcriptional activity by inhibiting dimer formation and decreasing protein stability.
12701690 2003 Further evidence of hepatic transdifferentiation in hepatoid adenocarcinomas of the stomach: quantitative analysis of mRNA for albumin and hepatocyte nuclear factor-4alpha.
12697672 2003 Hepatocyte nuclear factor 4 alpha isoforms originated from the P1 promoter are expressed in human pancreatic beta-cells and exhibit stronger transcriptional potentials than P2 promoter-driven isoforms.
12669197 2003 T130I mutation in HNF-4alpha gene is a loss-of-function mutation in hepatocytes and is associated with late-onset Type 2 diabetes mellitus in Japanese subjects.
12631740 2003 Mechanism of a transcriptional cross talk between transforming growth factor-beta-regulated Smad3 and Smad4 proteins and orphan nuclear receptor hepatocyte nuclear factor-4.
12627330 2003 Genetic epidemiology of MODY in the Czech republic: new mutations in the MODY genes HNF-4alpha, GCK and HNF-1alpha.
12551987 2003 Distinct modes of regulation of transcription of hepatitis B virus by the nuclear receptors HNF4alpha and COUP-TF1.
12544512 2003 Hepatocyte nuclear factor-4 alpha/gamma and hepatocyte nuclear factor-1 alpha as causal factors of interindividual difference in the expression of human dihydrodiol dehydrogenase 4 mRNA in human livers.
12522137 2003 Suppression of hepatitis B virus core promoter by the nuclear orphan receptor TR4.
12519792 2003 Hepatocyte nuclear factor-4 is a novel downstream target of insulin via FKHR as a signal-regulated transcriptional inhibitor.
12504020 2002 Dynamics of enhancer-promoter communication during differentiation-induced gene activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12413008 2002 Maturity-onset diabetes of the young resulting from a novel mutation in the HNF-4alpha gene.
12235114 2002 Genetic evidence that HNF-1alpha-dependent transcriptional control of HNF-4alpha is essential for human pancreatic beta cell function.
12220494 2002 Hepatocyte nuclear factor 4 is a transcription factor that constitutively binds fatty acids.
12203996 2002 Large Family With Maturity-Onset Diabetes of the Young and a Novel V121I Mutation in HNF4A.
12133007 2002 Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line.
12110948 2002 Mutations in hepatocyte nuclear factor 4alpha (HNF4alpha) gene associated with diabetes result in greater loss of HNF4alpha function in pancreatic beta-cells than in nonpancreatic beta-cells and in reduced activation of the apolipoprotein CIII promoter in hepatic cells.
12101254 2002 TRAP/SMCC/mediator-dependent transcriptional activation from DNA and chromatin templates by orphan nuclear receptor hepatocyte nuclear factor 4.
12089346 2002 Polyamines modulate the interaction between nuclear receptors and vitamin D receptor-interacting protein 205.
12086970 2002 Maturity-onset diabetes of the young caused by a balanced translocation where the 20q12 break point results in disruption upstream of the coding region of hepatocyte nuclear factor-4alpha (HNF4A) gene.
12083813 2002 The role of the HNF4alpha enhancer in type 2 diabetes.
12050210 2002 Nine novel mutations in maturity-onset diabetes of the young (MODY) candidate genes in 22 Spanish families.
12036449 2002 Hepatocyte nuclear factor (HNF)-4alpha induces expression of endothelial Fas ligand (FasL) to prevent cancer cell transmigration: a novel defense mechanism of endothelium against cancer metastasis.
11994285 2002 Activation of the insulin gene promoter through a direct effect of hepatocyte nuclear factor 4 alpha.
11916906 2002 Thyroid hormone receptor interacting protein 3 (trip3) is a novel coactivator of hepatocyte nuclear factor-4alpha.
11834723 2002 Analysis of gene expression profile induced by hepatocyte nuclear factor 4alpha in hepatoma cells using an oligonucleotide microarray.
11818510 2002 Repression of hepatocyte nuclear factor 4alpha tumor suppressor p53: involvement of the ligand-binding domain and histone deacetylase activity.
11811951 2002 Transcriptional control of the human aldehyde dehydrogenase 2 promoter by hepatocyte nuclear factor 4: inhibition by cyclic AMP and COUP transcription factors.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11772903 2002 Screening for MODY mutations, GAD antibodies, and type 1 diabetes--associated HLA genotypes in women with gestational diabetes mellitus.
11741883 2002 Hepatocyte nuclear factor-4alpha mediates redox sensitivity of inducible nitric-oxide synthase gene transcription.
11733490 2002 Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta ), a novel PGC-1-related transcription coactivator associated with host cell factor.
11717395 2001 A transcription factor regulatory circuit in differentiated pancreatic cells.
11590126 2001 A distant upstream promoter of the HNF-4alpha gene connects the transcription factors involved in maturity-onset diabetes of the young.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
11229886 2001 Transcriptional regulation of the human apolipoprotein genes.
10995777 2000 SMAD proteins transactivate the human ApoCIII promoter by interacting physically and functionally with hepatocyte nuclear factor 4.
10786636 2000 Nuclear receptor binding factor-2 (NRBF-2), a possible gene activator protein interacting with nuclear hormone receptors.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10652338 2000 Transcription activation by the orphan nuclear receptor, chicken ovalbumin upstream promoter-transcription factor I (COUP-TFI). Definition of the domain involved in the glucocorticoid response of the phosphoenolpyruvate carboxykinase gene.
10609119 1999 Monogenic diabetes mellitus in youth. The MODY syndromes.
10551874 1999 Mitogen-activated protein kinase regulates transcription of the ApoCIII gene. Involvement of the orphan nuclear receptor HNF4.
10389854 1999 Functional characterization of the MODY1 gene mutations HNF4(R127W), HNF4(V255M), and HNF4(E276Q).
10330009 1999 Regulation of alpha1-antitrypsin gene expression in human intestinal epithelial cell line caco-2 by HNF-1alpha and HNF-4.
10085149 1999 CREB-binding protein is a transcriptional coactivator for hepatocyte nuclear factor-4 and enhances apolipoprotein gene expression.
9812974 1998 SRC-1 and GRIP1 coactivate transcription with hepatocyte nuclear factor 4.
9795230 1998 Nuclear receptor binding factor-1 (NRBF-1), a protein interacting with a wide spectrum of nuclear hormone receptors.
9792724 1998 Retinoic acid mediates down-regulation of the alpha-fetoprotein gene through decreased expression of hepatocyte nuclear factors.
9717844 1998 Estrogen receptor, a common interaction partner for a subset of nuclear receptors.
9449683 1998 A missense mutation in hepatocyte nuclear factor-4 alpha, resulting in a reduced transactivation activity, in human late-onset non-insulin-dependent diabetes mellitus.
9434765 1997 Functional association between CBP and HNF4 in trans-activation.
9371825 1997 The maturity-onset diabetes of the young (MODY1) transcription factor HNF4alpha regulates expression of genes required for glucose transport and metabolism.
9313765 1997 Organization and partial sequence of the hepatocyte nuclear factor-4 alpha/MODY1 gene and identification of a missense mutation, R127W, in a Japanese family with MODY.
9294105 1997 Hepatic function in a family with a nonsense mutation (R154X) in the hepatocyte nuclear factor-4alpha/MODY1 gene.
9267996 1997 Studies of the genetic variability of the coding region of the hepatocyte nuclear factor-4alpha in Caucasians with maturity onset NIDDM.
9243109 1997 A missense mutation in the hepatocyte nuclear factor 4 alpha gene in a UK pedigree with maturity-onset diabetes of the young.
9115274 1997 Differential interaction of nuclear receptors with the putative human transcriptional coactivator hTIF1.
9048927 1997 Human hepatocyte nuclear factor-4 (hHNF-4) gene maps to 20q12-q13.1 between PLCG1 and D20S17.
8964514 1996 Isolation and characterization of a third isoform of human hepatocyte nuclear factor 4.
8945471 1996 Mutations in the hepatocyte nuclear factor-4alpha gene in maturity-onset diabetes of the young (MODY1)
8622695 1996 Human hepatocyte nuclear factor 4 isoforms are encoded by distinct and differentially expressed genes.
7926813 1994 Cloning and sequencing of cDNAs encoding the human hepatocyte nuclear factor 4 indicate the presence of two isoforms in human liver.
7651430 1995 Exclusive homodimerization of the orphan receptor hepatocyte nuclear factor 4 defines a new subclass of nuclear receptors.
7615825 1995 Intestinal apolipoprotein AI gene transcription is regulated by multiple distinct DNA elements and is synergistically activated by the orphan nuclear receptor, hepatocyte nuclear factor 4.
7568236 1995 Recruitment of hepatocyte nuclear factor 4 into specific intranuclear compartments depends on tyrosine phosphorylation that affects its DNA-binding and transactivation potential.
1899928 1991 Gene for non-insulin-dependent diabetes mellitus (maturity-onset diabetes of the young subtype) is linked to DNA polymorphism on human chromosome 20q.