Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.11
PubTator Score 3.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (6)

AA Sequence

MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTD      1 - 70
THKKKRKHSSDDYYYGDISSLESSQKKKKKSSPQSTDTAMDLLKAITSPLAAGSKPSKKTGEKSSGSSSH     71 - 140
SESKKEHHRKKVSGSSGELPLEDGGSHKSKKMKPLYVNTETLTLREPDGLKMKLILSPKEKGSSSVDEES    141 - 210
FQYPSQQATVKKSSKKSARDEQGALLLGHELQSFLKTARKKHKSSSDAHSSPGPEGCGSDASQFAESHSA    211 - 280
NLDLSGLEPILVESDSSSGGELEAGELVIDDSYREIKKKKKSKKSKKKKDKEKHKEKRHSKSKRSLGLSA    281 - 350
VPVGEVTVTSGPPPSIPYAGAAAPPLPLPGLHTDGHSEKKKKKEEKDKERERGEKPKKKNMSAYQVFCKE    351 - 420
YRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKA    421 - 490
SSVGVLSPQKKSPPTTMLLPASPAKAPETEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLD    491 - 560
SIICALGPLACLTTQLPELNGCPKQVLSNTLDNIAYIMPGL                                 561 - 601
//

Text Mined References (19)

PMID Year Title