Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.80
PubTator Score 22.90

Knowledge Summary


No data available


  Differential Expression (13)

Gene RIF (23)

25986072 A null-variant in HMCN1 (c.4162delC), has been identified in a Tunisian Jewish family with early-onset age-related macular degeneration.
25338956 The identified variants of HMCN1 are on conserved domains, particularly the two variants on calcium-binding epidermal growth factor domain.
24951538 Fibulin-6, a fibroblast-released extracellular matrix protein, may play an important role during myocardial remodelling by imparting an effect on cardiac fibroblasts migration in close and complementary interplay with TGF-beta1 signalling
24912920 HMCN1 mutation is associated with gastric and colorectal cancers.
24604465 this is the first association study based on a candidate gene approach to confirm that a HMCN1 polymorphism (rs2891230) is associated with postpartum depression diagnosis. heterozygosity (GA) for this SNP was associated with an increased risk of PPD.
22981695 Constructs show that EGF repeats 4 and 5 are required for hemicentin-dependent assembly and function of transgenic fibulin-1D in native locations.
20299368 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19229767 Dysregulation of fibulin expression by anti-Ro/SSA antibodies may contribute to disorganization of the extracellular environment and thus cause injury to the salivary gland architecture and functionality observed in Sjogren syndrome
19190085 down-regulated in salivary gland epithelial cell from Sjogren's syndrome patients following in vitro treatment with anti-Ro/SSA auto-antibodies; associated with increase in anoikis cell death
17591627 Observational study of gene-disease association. (HuGE Navigator)
17591627 hemicentin-1 gene appears to play a role in both age-related macular degeneration and renal pathophysiology
17216616 Observational study of gene-disease association. (HuGE Navigator)
17216616 Data shows that low-frequency variants encoding possible functional amino acid polymorphisms in the HMCN1 gene may not contribute substantially to disease, but HMCN1 mutations may still confer disease susceptibility in a small subset of patients.
17157600 Observational study of gene-disease association. (HuGE Navigator)
17157600 The CFH gene and Hemicentin-1 genes do not appear to be involved in a statistically significant fraction of dry AMD (age-related macular degeneration) cases in the Japanese population.
17057786 Observational study of gene-disease association. (HuGE Navigator)
17057786 We were not able to demonstrate an association between the Hemicentin-1, hOgg1, and E-selectin SNPs and age-related macular degeneration development in the currently available cases and controls.
16885922 Observational study of gene-disease association. (HuGE Navigator)
16885922 None of our subjects (258 macular degeneration,AMD, cases, 72 non-AMD controls) had the Gln5345Arg variant in the HMCN1 gene.
15467524 Observational study of genotype prevalence, gene-disease association, and genetic testing. (HuGE Navigator)
15370542 Observational study of gene-disease association. (HuGE Navigator)
14570714 We mapped the ARMD1 gene. Identification of the genes involved in AMD will lead to a better understanding of this disease at the molecular level.

AA Sequence

ETYRMRVRASSYSANGTIEYQTTFIVYIAVSAYPY                                      5601 - 5635

Text Mined References (27)

PMID Year Title
25986072 2015 Rare genetic variants in Tunisian Jewish patients suffering from age-related macular degeneration.
25338956 2014 Genome-wide linkage and exome analyses identify variants of HMCN1 for splenic epidermoid cyst.
24951538 2014 Expression of fibulin-6 in failing hearts and its role for cardiac fibroblast migration.
24912920 2015 HMCN1, a cell polarity-related gene, is somatically mutated in gastric and colorectal cancers.
24604465 HMNC1 gene polymorphism associated with postpartum depression.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22981695 2012 Distinct regions within fibulin-1D modulate interactions with hemicentin.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
20299368 2010 Examination of association with candidate genes for diabetic nephropathy in a Mexican American population.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19229767 Anti-Ro/SSA autoantibody-mediated regulation of extracellular matrix fibulins in human epithelial cells of the salivary gland.
19190085 2009 Fibulin-6 expression and anoikis in human salivary gland epithelial cells: implications in Sjogren's syndrome.
17591627 2007 Complement factor H and hemicentin-1 in age-related macular degeneration and renal phenotypes.
17216616 2007 Case-control genetic association study of fibulin-6 (FBLN6 or HMCN1) variants in age-related macular degeneration (AMD).
17157600 2006 Polymorphisms in Complement Factor H and Hemicentin-1 genes in a Japanese population with dry-type age-related macular degeneration.
17057786 2005 Analysis of Hemicentin-1, hOgg1, and E-selectin single nucleotide polymorphisms in age-related macular degeneration.
16885922 2006 Analysis of variants in the complement factor H, the elongation of very long chain fatty acids-like 4 and the hemicentin 1 genes of age-related macular degeneration in the Finnish population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15467524 2004 A novel diagnostic test detects a low frequency of the hemicentin Gln5345Arg variant among Northern Irish age related macular degeneration patients.
15370542 2004 Evaluation of the ARMD1 locus on 1q25-31 in patients with age-related maculopathy: genetic variation in laminin genes and in exon 104 of HEMICENTIN-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14570714 2003 Analysis of the ARMD1 locus: evidence that a mutation in HEMICENTIN-1 is associated with age-related macular degeneration in a large family.
12388743 2002 Distribution and evolution of von Willebrand/integrin A domains: widely dispersed domains with roles in cell adhesion and elsewhere.
11222143 2001 Hemicentin, a conserved extracellular member of the immunoglobulin superfamily, organizes epithelial and other cell attachments into oriented line-shaped junctions.
9715689 1998 Age-related macular degeneration. Clinical features in a large family and linkage to chromosome 1q.