Property Summary

NCBI Gene PubMed Count 31
PubMed Score 296.93
PubTator Score 405.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.033 1.6e-04
pancreatic ductal adenocarcinoma liver m... -1.444 6.1e-03
Breast cancer 1.300 9.3e-16
invasive ductal carcinoma 1.200 1.0e-02
ovarian cancer 1.200 1.3e-04
pituitary cancer -1.500 1.0e-05

Gene RIF (12)

PMID Text
22190034 HIV-1 gp160 is identified to have a physical interaction with histocompatibility (minor) 13 (HM13) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21636854 structure of human SPP [SPP]
16834339 Upon isolation of membranes and solubilization with detergent, the biochemical characteristics of SPP are remarkably similar to gamma-secretase.
16738546 data implicate SPP in the US2 pathway and indicate the possibility of a previously unknown function for this intramembrane-cleaving aspartic protease in dislocation from the endoplasmic reticulum
16730383 Compares a variant from the mouse ortholog to the human gene.
15385547 SPP, SPPL2a, -2b, -2c, and -3 probably cleave type II-oriented substrate peptides as shown by consensus analysis
14988012 The peptide structure corresponding to the C-terminal residues from H13 ribosomal protein was determined using magnetic resonance spectroscopy.
14741365 IMP1 is a bi-aspartic polytopic protease capable of cleaving transmembrane proteins such as presenilin 2.
14704149 signal peptide peptidase forms a homodimer that is labeled by an active site-directed gamma-secretase inhibitor
12972007 widespread expression of SPP in many tissues
12139484 identification and molecular cloning; expression analysis of the hIMP1 gene (located on chromosome 20) was performed in human cell tissues and transfected cell cultures [IMP1]
12077416 identified human signal peptide peptidase as a polytopic membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases [SPP]

AA Sequence

MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETI      1 - 70
TSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQL     71 - 140
LFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCI    141 - 210
LLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFD    211 - 280
ISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESN    281 - 350
PKDPAAVTESKEGTEASASKGLEKKEK                                               351 - 377
//

Text Mined References (36)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25239945 2014 Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21636854 2011 Three-dimensional structure of the signal peptide peptidase.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19942855 2010 Protein disulphide isomerase is required for signal peptide peptidase-mediated protein degradation.
19720873 2009 The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17965014 2008 Regulated intramembrane proteolysis of Bri2 (Itm2b) by ADAM10 and SPPL2a/SPPL2b.
17291163 2007 A screen for retrotransposed imprinted genes reveals an association between X chromosome homology and maternal germ-line methylation.
16873890 2006 Intramembrane proteolytic cleavage by human signal peptide peptidase like 3 and malaria signal peptide peptidase.
16834339 2006 Signal peptide peptidase: biochemical properties and modulation by nonsteroidal antiinflammatory drugs.
16829952 2006 SPPL2a and SPPL2b promote intramembrane proteolysis of TNFalpha in activated dendritic cells to trigger IL-12 production.
16738546 2006 Signal peptide peptidase is required for dislocation from the endoplasmic reticulum.
16730383 Cell-surface expression of a new splice variant of the mouse signal peptide peptidase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15998642 2005 Differential localization and identification of a critical aspartate suggest non-redundant proteolytic functions of the presenilin homologues SPPL2b and SPPL3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385547 2004 Consensus analysis of signal peptide peptidase and homologous human aspartic proteases reveals opposite topology of catalytic domains compared with presenilins.
14988012 2004 Correlation between conformation and antibody binding: NMR structure of cross-reactive peptides from T. cruzi, human and L. braziliensis.
14741365 2004 Impas 1 possesses endoproteolytic activity against multipass membrane protein substrate cleaving the presenilin 1 holoprotein.
14704149 2004 Signal peptide peptidase forms a homodimer that is labeled by an active site-directed gamma-secretase inhibitor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12972007 2003 Expression of the presenilin-like signal peptide peptidase (SPP) in mouse adult brain and during development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419218 2002 Requirements for signal peptide peptidase-catalyzed intramembrane proteolysis.
12145199 2002 Intramembrane proteolysis promotes trafficking of hepatitis C virus core protein to lipid droplets.
12139484 2002 Novel class of polytopic proteins with domains associated with putative protease activity.
12077416 2002 Identification of signal peptide peptidase, a presenilin-type aspartic protease.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11714810 2001 Intramembrane proteolysis of signal peptides: an essential step in the generation of HLA-E epitopes.