Property Summary

NCBI Gene PubMed Count 21
PubMed Score 47.93
PubTator Score 41.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.709 1.7e-04
tuberculosis 2.200 3.8e-08
non-small cell lung cancer -1.725 2.4e-19
mucosa-associated lymphoid tissue lympho... 1.434 8.1e-03
psoriasis 1.200 7.4e-22

Protein-protein Interaction (5)

Gene RIF (10)

PMID Text
26855992 HK1 and HK2 expression alterations were detected, that could be explained by common deregulation mechanisms of these genes in colorectal tumors. The HK3 expression level was significantly increased in 60% of samples.
25766729 The transport of glucose across the cell membrane by glucose transporters (GLUTs) and intracellular phosphorylation by hexokinases (HKs) are the initial steps of the glycolytic pathway.
25172542 Through glycolysis and arachidonic acid metabolism, HK3 and PTGS2 might play important roles in pediatric ALL and its prognosis, and thus, might be potential targets for therapeutic intervention to suppress pediatric ALL.
24584857 Altogether, our data provide an explanation for low HK3 and KLF5 expression in particular AML subtype and establish these genes as novel CEBPA targets during neutrophil differentiation.
22498738 HK3 is: (1) directly activated by PU.1, (2) repressed by PML-RARA, and (3) functionally involved in neutrophil differentiation and cell viability of acute promyelocytic leukemia cells.
21072205 Data show that HKIII exerts protective effects against oxidative stress, perhaps by increasing ATP levels, reducing oxidant-induced ROS production, preserving mitochondrial membrane potential, and increasing mitochondrial biogenesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19554504 The expression pattern of HK3 is reported in newly diagnosed esophageal adenocarcinoma by means of immunohistochemistry.
19448621 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17868400 Data demonstrated that in addition to galectin-3, HK III and cyclin A profiles could be important biomarkers in predicting malignancy in follicular thyroid nodules.

AA Sequence

MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAP      1 - 70
AVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLF     71 - 140
DFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQG    141 - 210
AYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEARHVAVLDEDRGRVCVSVEWGSFSDD    211 - 280
GALGPVLTTFDHTLDHESLNPGAQRFEKMIGGLYLGELVRLVLAHLARCGVLFGGCTSPALLSQGSILLE    281 - 350
HVAEMEDPSTGAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQ    351 - 420
VAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSLIPSVDGGGRGVAMVTAVAARLAAHRRLLEETLAPF    421 - 490
RLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTFVRATPDGSERGDFLALDLGGTNFRVLLVRVTTGVQ    491 - 560
ITSEIYSIPETVAQGSGQQLFDHIVDCIVDFQQKQGLSGQSLPLGFTFSFPCRQLGLDQGILLNWTKGFK    561 - 630
ASDCEGQDVVSLLREAITRRQAVELNVVAIVNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVA    631 - 700
GVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSL    701 - 770
GVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLC    771 - 840
GAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGSGKGAALV    841 - 910
TAVACRLAQLTRV                                                             911 - 923
//

Text Mined References (23)

PMID Year Title
26855992 [Evaluation of Gene Expression of Hexokinases in Colorectal Cancer with the Use of Bioinformatics Methods].
25766729 2016 High 18F-FDG uptake in PMAH correlated with normal expression of Glut1, HK1, HK2, and HK3.
25172542 2015 Identification of key genes affecting disease free survival time of pediatric acute lymphoblastic leukemia based on bioinformatic analysis.
24584857 2014 CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.
22498738 2012 PU.1 is linking the glycolytic enzyme HK3 in neutrophil differentiation and survival of APL cells.
21072205 2010 Regulation and cytoprotective role of hexokinase III.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19554504 2009 Expression of hexokinases and glucose transporters in treated and untreated oesophageal adenocarcinoma.
19448621 2009 Genome-wide association studies identify loci associated with age at menarche and age at natural menopause.
17868400 2008 Hexokinase III, cyclin A and galectin-3 are overexpressed in malignant follicular thyroid nodules.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12488461 2002 The human plasma proteome: history, character, and diagnostic prospects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11068878 2000 Interaction of insulin-like growth factor binding protein-4, Miz-1, leptin, lipocalin-type prostaglandin D synthase, and granulin precursor with the N-terminal half of type III hexokinase.
9468341 1998 Hexokinase isoenzymes in normal and cirrhotic human liver: suppression of glucokinase in cirrhosis.
8941369 1996 Assignment of the hexokinase type 3 gene (HK3) to human chromosome band 5q35.3 by somatic cell hybrids and in situ hybridization.
8812439 1996 Sequence of human hexokinase III cDNA and assignment of the human hexokinase III gene (HK3) to chromosome band 5q35.2 by fluorescence in situ hybridization.
8717435 1996 Purification and characterization of the carboxyl-domain of human hexokinase type III expressed as fusion protein.
7150652 1982 Compartmentation of hexokinase in human blood cells. Characterization of soluble and particulate enzymes.
4058069 On the developmental properties and tissue interactions of hexokinase.
1190733 1975 Genetically determined polymorphism of a form of hexokinase, HK III, found in human leucocytes.