Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.33
PubTator Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Esophageal Squamous Cell Carcinoma 77 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 1.7e-04

Gene RIF (6)

AA Sequence

MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (31)

PMID Year Title