Property Summary

NCBI Gene PubMed Count 32
PubMed Score 59.36
PubTator Score 36.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer -1.400 1.3e-02
hepatocellular carcinoma -1.100 5.4e-03
malignant mesothelioma 3.100 1.3e-06
Multiple Sclerosis -1.500 1.6e-05
lung adenocarcinoma 1.400 3.7e-06
acute myeloid leukemia -2.400 3.4e-02
Breast cancer 1.300 9.4e-08

Gene RIF (10)

PMID Text
25584861 Histone H1 organizes and maintains an extensive protein-protein interaction network in the nucleolus required for nucleolar structure and integrity.
24690621 Tandem affinity purification and mass spectrometry analysis identify H1d associated HIV-1 Gag in 293T cells
24525734 Integration with apoptotic intermediates (via C-terminal tail interactions) may constitute a more generalized function of linker histone isoforms in apoptotic cascades.
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
21425800 Tandem affinity purification and mass spectrometry analysis identify H1d associated HIV-1 Gag in 293T cells
20846217 Observational study of gene-disease association. (HuGE Navigator)
20685720 overexpression of histone cluster 1 is associated with recurrence in meningiomas.
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
15595731 confirmed N-terminal acetylation on all isoforms plus a single internal acetylation site; phosphorylation sites were located on peptides containing the cyclin dependent kinase (CDK) consensus motif

AA Sequence

MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAA      1 - 70
GYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPK     71 - 140
KVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKV    141 - 210
TKAKKAAPKKK                                                               211 - 221
//

Text Mined References (39)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25584861 2015 Proteomic characterization of the nucleolar linker histone H1 interaction network.
24525734 2014 The C-terminal domain (CTD) in linker histones antagonizes anti-apoptotic proteins to modulate apoptotic outcomes at the mitochondrion.
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20685720 2010 Differential expression profiling analyses identifies downregulation of 1p, 6q, and 14q genes and overexpression of 6p histone cluster 1 genes as markers of recurrence in meningiomas.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19882353 2010 Histone H1 subtype preferences of DFF40 and possible nuclear localization of DFF40/45 in normal and trichostatin A-treated NB4 leukemic cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15911621 2005 H1 family histones in the nucleus. Control of binding and localization by the C-terminal domain.
15635413 2005 Nucleolar proteome dynamics.
15595731 Characterization of phosphorylation sites on histone H1 isoforms by tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11746507 2001 Distribution of somatic H1 subtypes is non-random on active vs. inactive chromatin II: distribution in human adult fibroblasts.
11478838 2001 Nuclear envelope and chromatin compositional differences comparing undifferentiated and retinoic acid- and phorbol ester-treated HL-60 cells.
11467742 2001 A compendium of the histone H1 family of somatic subtypes: an elusive cast of characters and their characteristics.
10997781 2000 The distribution of somatic H1 subtypes is non-random on active vs. inactive chromatin: distribution in human fetal fibroblasts.
9439656 1997 The human histone gene cluster at the D6S105 locus.
9119399 1997 Human histone gene organization: nonregular arrangement within a large cluster.
8325638 1993 All known human H1 histone genes except the H1(0) gene are clustered on chromosome 6.
8003976 1994 A proposal for a coherent mammalian histone H1 nomenclature correlated with amino acid sequences.
2613692 1989 Human spleen histone H1. Isolation and amino acid sequences of three minor variants, H1a, H1c, and H1d.
2071153 1991 Single-copy flanking sequences in human histone gene clusters map to chromosomes 1 and 6.
1916825 1991 Isolation and characterization of two human H1 histone genes within clusters of core histone genes.