Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.56
PubTator Score 13.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.554 6.1e-03
Atopic dermatitis -1.300 5.2e-03
Breast cancer 1.800 1.6e-14
colon cancer 1.600 1.6e-02
esophageal adenocarcinoma -1.500 2.8e-02
glioblastoma multiforme 2.000 1.7e-14
lung adenocarcinoma 1.100 2.4e-04
lung cancer 1.300 2.9e-02
non-small cell lung cancer 1.938 2.1e-14
osteosarcoma 3.494 3.6e-06
ovarian cancer 1.300 6.0e-03
pancreatic cancer 1.300 1.4e-03
posterior fossa group A ependymoma 1.400 6.3e-04
primary pancreatic ductal adenocarcinoma 1.976 2.5e-02
psoriasis 1.700 8.2e-05
tuberculosis -5.100 1.3e-08
ulcerative colitis 1.100 3.5e-04

 GO Function (1)

Gene RIF (8)

AA Sequence

MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM             1 - 63
//

Text Mined References (18)

PMID Year Title