Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 1.9e-14
ovarian cancer 8520 3.8e-10
malignant mesothelioma 3232 2.8e-06
lung cancer 4740 2.0e-04
osteosarcoma 7950 2.4e-04
psoriasis 6694 4.8e-04

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.200 1.9e-14
lung cancer 1.100 2.0e-04
malignant mesothelioma 1.400 2.8e-06
osteosarcoma 1.017 2.4e-04
ovarian cancer 1.200 3.8e-10
psoriasis 2.100 4.8e-04

Synonym

Accession Q9BTY7 P0CB43
Symbols BRP16
BRP16L
FAM203A
FAM203B
C8orf30A
C8orf30B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGEAGAGAGASGGPEASPEAEVVKLLPFLAPGARADLQAAAVRHVLALTGCGPGRALLAGQAALLQALME      1 - 70
LAPASAPARDAARALVNLAADPGLHETLLAADPGLPARLMGRALDPQWPWAEEAAAALANLSREPAPCAA     71 - 140
LMAALAAAEPADSGLERLVRALCTPGYNARAPLHYLAPLLSNLSQRPAARAFLLDPDRCVVQRLLPLTQY    141 - 210
PDSSVRRGGVVGTLRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYLPPDKQRE    211 - 280
PDADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENL    281 - 350
LEVQVPEDVEQQLQQLDCREQEQLERELAPEPWVERATPT                                  351 - 390
//

Text Mined References (12)

PMID Year Title