Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3098 1.9e-14
ovarian cancer 8491 3.8e-10
osteosarcoma 7933 6.8e-07
malignant mesothelioma 3163 2.8e-06
lung cancer 4473 2.0e-04
psoriasis 6685 4.8e-04

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.400 2.8e-06
psoriasis 2.100 4.8e-04
osteosarcoma 1.390 6.8e-07
lung cancer 1.100 2.0e-04
Breast cancer 1.200 1.9e-14
ovarian cancer 1.200 3.8e-10

Gene RIF (1)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with family with sequence similarity 203, member A (FAM203A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MGEAGAGAGASGGPEASPEAEVVKLLPFLAPGARADLQAAAVRHVLALTGCGPGRALLAGQAALLQALME      1 - 70
LAPASAPARDAARALVNLAADPGLHETLLAADPGLPARLMGRALDPQWPWAEEAAAALANLSREPAPCAA     71 - 140
LMAALAAAEPADSGLERLVRALCTPGYNARAPLHYLAPLLSNLSQRPAARAFLLDPDRCVVQRLLPLTQY    141 - 210
PDSSVRRGGVVGTLRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYLPPDKQRE    211 - 280
PDADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENL    281 - 350
LEVQVPEDVEQQLQQLDCREQEQLERELAPEPWVERATPT                                  351 - 390
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.