Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.54
PubTator Score 0.50

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
psoriasis 6685 3.1e-282
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Congenital diaphragmatic hernia 44 3.297 1.6
Colorectal adenoma 15 3.204 1.6


  Differential Expression (1)

Disease log2 FC p
psoriasis 6.200 3.1e-282

Gene RIF (1)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

IIGLLLLITTVILSLRLCSAMKQTDYQQVQSCALPTDAL                                  1121 - 1159

Text Mined References (5)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20685892 2010 Identification of zyklopen, a new member of the vertebrate multicopper ferroxidase family, and characterization in rodents and human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.