Property Summary

NCBI Gene PubMed Count 22
PubMed Score 21.54
PubTator Score 18.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.3e-08
hepatocellular carcinoma 547 9.0e-03
pancreatic cancer 2398 2.3e-02
pancreatic carcinoma 562 2.3e-02
acute myeloid leukemia 783 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Retinitis pigmentosa 59 11 5.252 2.6
Isolated cleft palate 4 3.364 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -2.200 3.4e-02
hepatocellular carcinoma 1.100 9.0e-03
osteosarcoma -7.103 7.3e-08
pancreatic cancer 1.500 2.3e-02
pancreatic carcinoma 1.500 2.3e-02

Gene RIF (11)

AA Sequence

MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGK      1 - 70
GNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQES     71 - 140
NIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISV    141 - 210
IQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAE    211 - 280
PEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSE    281 - 350
DYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPK    351 - 420
ECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF          421 - 484
//

Text Mined References (25)

PMID Year Title