Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.48
PubTator Score 104.53

Knowledge Summary

Patent

No data available

Gene RIF (7)

PMID Text
26721387 HDGFRP2 promotes DNA repair by homologous recombination.
25689719 HRP-2 is frequently overexpressed in human hepatocellular carcinoma tissues at mRNA and protein levels. HRP-2 can promote hepatocellular carcinoma cells growth in vitro and xenograft tumors in vivo.
23046603 Authors show that HRP-2 functions as a co-factor of HIV-1 IN in LEDGF/p75-depleted cells.
23046603 Hepatoma-derived growth factor 2 (HRP2) restores salt-stripped HIV-1 preintegration complex (PIC) activity in vitro
16337983 Here, we show that recombinant HDGF2 host cell factor efficiently reconstitutes the in vitro activity of HIV-1 preintegration complexes.
16337983 Hepatoma-derived growth factor 2 (HRP2) restores salt-stripped HIV-1 preintegration complex (PIC) activity in vitro
15797927 Hepatoma-derived growth factor 2 (HRP2) restores salt-stripped HIV-1 preintegration complex (PIC) activity in vitro

AA Sequence

MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGK      1 - 70
PNKRKGFNEGLWEIQNNPHASYSAPPPVSSSDSEAPEANPADGSDADEDDEDRGVMAVTAVTATAASDRM     71 - 140
ESDSDSDKSSDNSGLKRKTPALKMSVSKRARKASSDLDQASVSPSEEENSESSSESEKTSDQDFTPEKKA    141 - 210
AVRAPRRGPLGGRKKKKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPA    211 - 280
EKPLPKPRGRKPKPERPPSSSSSDSDSDEVDRISEWKRRDEARRRELEARRRREQEEELRRLREQEKEEK    281 - 350
ERRRERADRGEAERGSGGSSGDELREDDEPVKKRGRKGRGRGPPSSSDSEPEAELEREAKKSAKKPQSSS    351 - 420
TEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALKVDS    421 - 490
PDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQK    491 - 560
VNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPSTDLSAPVNGEATSQKGESAEDKEHEEGRDSEEGPR    561 - 630
CGSSEDLHDSVREGPDLDRPGSDRQERERARGDSEALDEES                                 631 - 671
//

Text Mined References (18)

PMID Year Title
26721387 2016 Hepatoma-derived growth factor-related protein 2 promotes DNA repair by homologous recombination.
25689719 2015 HDGF-related protein-2 (HRP-2) acts as an oncogene to promote cell growth in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23046603 2012 HRP-2 determines HIV-1 integration site selection in LEDGF/p75 depleted cells.
22396646 2012 LEDGF/p75-independent HIV-1 replication demonstrates a role for HRP-2 and remains sensitive to inhibition by LEDGINs.
21720545 2011 Structural and histone binding ability characterizations of human PWWP domains.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16337983 2006 Biochemical and genetic analyses of integrase-interacting proteins lens epithelium-derived growth factor (LEDGF)/p75 and hepatoma-derived growth factor related protein 2 (HRP2) in preintegration complex function and HIV-1 replication.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9299445 1997 Hepatoma-derived growth factor belongs to a gene family in mice showing significant homology in the amino terminus.