Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.97
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.7e-11
osteosarcoma 7950 3.4e-10
medulloblastoma, large-cell 6241 7.2e-05
Disease Target Count Z-score Confidence
Tic disorder 8 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 7.2e-05
osteosarcoma 2.428 3.4e-10
ovarian cancer 1.300 1.7e-11

Gene RIF (1)

AA Sequence

MSAYGMPMYKSGDLVFAKLKGYAHWPARIEHMTQPNRYQVFFFGTHETAFLSPKRLFPYKECKEKFGKPN      1 - 70
KRRGFSAGLWEIENNPTVQASDCPLASEKGSGDGPWPEPEAAEGDEDKPTHAGGGGDELGKPDDDKPTEE     71 - 140
EKGPLKRSAGDPPEDAPKRPKEAAPDQEEEAEAERAAEAERAAAAAAATAVDEESPFLVAVENGSAPSEP    141 - 210
GLVCEPPQPEEEELREEEVADEEASQEWHAEAPGGGDRDSL                                 211 - 251
//

Text Mined References (6)

PMID Year Title