Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.92
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.7e-11
osteosarcoma 7933 3.4e-10
medulloblastoma, large-cell 6234 7.2e-05

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.428 3.4e-10
medulloblastoma, large-cell 1.300 7.2e-05
ovarian cancer 1.300 1.7e-11

Gene RIF (1)

PMID Text
20509080 The segment encompassed only one UCSC (University of California-Santa Cruz genome bioinformatics database) gene: HDGFL1 (Homo sapiens hepatoma derived growth factor like 1, GB #AL033539).

AA Sequence

MSAYGMPMYKSGDLVFAKLKGYAHWPARIEHMTQPNRYQVFFFGTHETAFLSPKRLFPYKECKEKFGKPN      1 - 70
KRRGFSAGLWEIENNPTVQASDCPLASEKGSGDGPWPEPEAAEGDEDKPTHAGGGGDELGKPDDDKPTEE     71 - 140
EKGPLKRSAGDPPEDAPKRPKEAAPDQEEEAEAERAAEAERAAAAAAATAVDEESPFLVAVENGSAPSEP    141 - 210
GLVCEPPQPEEEELREEEVADEEASQEWHAEAPGGGDRDSL                                 211 - 251
//

Text Mined References (6)

PMID Year Title
25742292 2015 Genome-wide association study of parity in Bangladeshi women.
25224454 2015 Genome-wide admixture and association study of serum iron, ferritin, transferrin saturation and total iron binding capacity in African Americans.
20509080 2010 Mild intellectual disability associated with a progeny of father-daughter incest: genetic and environmental considerations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.