Property Summary

NCBI Gene PubMed Count 136
PubMed Score 2983.51
PubTator Score 181.40

Knowledge Summary

Patent (25,283)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cancer 2346 4.115 2.1

Expression

Synonym

Gene

HCK

PDB

1AD5   1BU1   1QCF   2C0I   2C0O   2C0T   2HCK   2HK5   2OI3   2OJ2   3HCK   3NHN   3RBB   3REA   3REB   3VRY   3VRZ   3VS0   3VS1   3VS2   3VS3   3VS4   3VS5   3VS6   3VS7   4HCK   4LUD   4LUE   4ORZ   4U5W   5HCK  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (110)

PMID Text
26440750 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25972488 we provide evidence for involvement of HCK and FGR in FCRL4-mediated immunoregulation and for the functional importance of posttranslational modifications of the FCRL4 molecule.
25807049 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25745180 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25666803 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25527710 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
25122770 Interaction with the Src homology (SH3-SH2) region of the Hck structures the HIV-1 Nef dimer for kinase activation and effector recruitment.
25122770 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
24722985 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
24451644 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
24396731 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
24229420 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
24162774 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
24051604 Interaction between Nef and Hck is important for Nef-dependent modulation of viral infectivity.
24051604 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
23986795 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
23896410 Data indicate that combined treatment using SFK (LYN, HCK, or FGR) and c-KIT inhibitor dasatinib dasatinib and chemotherapy provides a novel approach to increasing p53 activity and enhancing targeting of acute myeloid leukemia (AML) stem cells.
23847689 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
23601552 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
23576497 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
23559827 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
23439650 The SRC family tyrosine kinase HCK and the ETS family transcription factors SPIB and EHF regulate transcytosis across a human follicle-associated epithelium model.
23352142 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
23317503 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
22651890 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
22641034 This particular binding mode enables Hck SH3 to sense a specific non-canonical residue situated in the SH3 RT-loop of the kinase.
22537596 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
22393415 the activation of Hck, Lyn and c-Src by Nef is highly conserved among all major clades of HIV-1
22393415 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
22345475 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
22185326 There were significant differences in the genotype and allele distribution of -627 G/T polymorphism in Hck gene between cases and controls.
22110726 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
22021612 we show that Hck, has a pre-eminent role in LPS/TLR4-induced TNF and IL-6 production.
21993313 Loss of HCK is associated with acute promyelocytic leukemia.
21878628 Hck acts as a key regulator controlling gene expression in alternatively activated monocytes/macrophages.
21763503 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
21738584 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
21696586 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
21625496 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
21567396 Hck activation at the Golgi apparatus causes the HIV-1 Nef-induced c-Fms proto-oncogene N-glycosylation defect.
21567396 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
21477083 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
21365684 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
20810664 Data show that the structures and relative orientations of the SH2 and SH3 domains down-regulated Hck.
20810664 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
20798061 BSS-SAXS reconstruction is used to reveal the structural organization of Hck in solution and the different shifts in the equilibrium population of assembly states upon the binding of different signaling peptides
20702582 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
20670214 Identification and biophysical assessment of the molecular recognition mechanisms between the human haemopoietic cell kinase Src homology domain 3 and ALG-2-interacting protein X.
20488787 Nef participates in HIV-1-induced multinucleated giant cells formation via a p61Hck- and lysosomal enzyme-dependent pathway
20488787 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
20181660 Taken together, PKR and Hck were critical for DON-induced ribosomal recruitment of p38, its subsequent phosphorylation, and, ultimately, p38-driven proinflammatory cytokine expression.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19807124 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
19585521 This finding establishes an intriguing link between the pathogenesis of Nef and a newly emerging concept that the Golgi-localized Src kinases regulate the Golgi function.
19585521 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
19211505 HCK and BIN1 plays critical roles in AHI-1-mediated leukemic transformation of cutaneous T-Cell Lymphoma.
19149577 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
18794796 Hck has a nonredundant function as a key downstream signaling partner for Bcr-Abl and may represent a potential drug target in CML
18005690 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
17893228 Nef perturbs the intracellular maturation and the trafficking of nascent Fms, through a unique mechanism that required both the activation of Hck and the aberrant spatial regulation of the active Hck
17893228 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
17668209 hematopoietic cell kinase (hct) phosphorylates fems-like tyrosine kinase 3(FLT3) in the JM region and inhibits its maturation
17535448 p73 is identified as a novel substrate and interacting partner of Hck and it regulates p73 through mechanisms that are dependent on either catalytic activity or protein interaction domains.
17141806 The structure of the HckSH3:PD1 complex reveals novel features of SH3 ligand binding and yields new insights into the structural basics of SH3-ligand interactions.
17024369 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17024369 Data suggest that the insertion/deletion polymorphism could be a functional polymorphism of the Hck gene, may contribute to COPD pathogenesis and modify COPD-related phenotypes.
16849330 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
16454711 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
16271895 The free energy surface shows that the N-terminal end of HCK acts as a reversible two-state conformational switch coupling the catalytic domain to the regulatory modules.
16210316 data support the existence of multiple active conformations of Src family member Hck kinase that may generate unique downstream signals
15638726 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
15626739 HIV-1 Nef interferes with M-CSF receptor signaling through Hck activation and thereby inhibits M-CSF functions in monocytes/macrophages.
15626739 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
15595833 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
15491611 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
15263807 In humans, the cytoplasmic domain of ADAM15v2 strongly interacts with Lck and Hck and regulates leukocyte function.
15078178 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
15010462 Gab2 docking proteins in IL-6-induced proliferation and survival of multiple myeloma cells.
14969582 SRC kinases LYN & HCK let engaged b2 integrins form focal-adhesion-like structures needed for stable shear-resistant PMN adhesion. SRC-dependent outside-in signalling is needed for integrin adhesiveness triggered by a classical chemoattractant like IL-8.
14551197 C3G and Hck interact physically and functionally in vivo to activate kinase-dependent and caspase-mediated apoptosis, which is independent of catalytic domain of C3G
12900520 These results suggest that CSF-induced and HIV-1-mediated regulation of Hck and C/EBPbeta represent the heterogeneous susceptibility of tissue macrophages to HIV-1 infection.
12734410 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
12600646 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
12592324 The interaction of the Bcr-Abl tyrosine kinase with this protein is mediated by multiple binding domains.
12076760 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
12033791 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
11976726 SH3-dependent stimulation of Src-family kinase autophosphorylation without tail release from the SH2 domain in vivo
11976726 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
11533201 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
11500821 A dominant negative form of Hck, in an interaction that is SH3 domain dependent, blocks HIV-1 Nef induced MHC class I downregulation.
11500821 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
11463741 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
11448168 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
11328823 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
11278465 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
10967098 Alternate use of a non-AUG (CUG), and an in-frame, downstream AUG translation initiation codon, results in the production of two isoforms with different subcellular localization.
10642173 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
10574946 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
10547288 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
10544125 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
10388555 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
10364375 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
9778343 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
9705913 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
9656992 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
9218412 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
8599760 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
7859737 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
7588629 HIV-1 Nef binds HCK without affecting SH2-tail interaction and impacts local dynamics near the HCK active site; these changes are reversed in the presence of a selective inhibitor of the Nef-HCK complex
1875927 Alternate use of a non-AUG (CUG), and an in-frame, downstream AUG translation initiation codon, results in the production of 2 isoforms in mouse and human.

AA Sequence

MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNT      1 - 70
PGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE     71 - 140
TEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYI    141 - 210
SPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMAT    211 - 280
YNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEG    281 - 350
SKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP    351 - 420
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIM    421 - 490
MRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP                                      491 - 526
//

Text Mined References (161)

PMID Year Title
25972488 2015 Involvement of the HCK and FGR src-family kinases in FCRL4-mediated immune regulation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25469238 2015 Molecular characterization of WDCP, a novel fusion partner for the anaplastic lymphoma tyrosine kinase ALK.
25416956 2014 A proteome-scale map of the human interactome network.
25122770 2014 Interaction with the Src homology (SH3-SH2) region of the Src-family kinase Hck structures the HIV-1 Nef dimer for kinase activation and effector recruitment.
24860872 2014 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24051604 2013 HIV-1 infection of T cells and macrophages are differentially modulated by virion-associated Hck: a Nef-dependent phenomenon.
23896410 2013 The Src and c-Kit kinase inhibitor dasatinib enhances p53-mediated targeting of human acute myeloid leukemia stem cells by chemotherapeutic agents.
23439650 2013 The SRC family tyrosine kinase HCK and the ETS family transcription factors SPIB and EHF regulate transcytosis across a human follicle-associated epithelium model.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22641034 2012 Structural recognition mechanisms between human Src homology domain 3 (SH3) and ALG-2-interacting protein X (Alix).
22393415 2012 Nef alleles from all major HIV-1 clades activate Src-family kinases and enhance HIV-1 replication in an inhibitor-sensitive manner.
22185326 2012 Hematopoietic cell kinase gene polymorphisms and the risk of chronic obstructive pulmonary disease in a Chinese population.
22021612 2011 Hck tyrosine kinase regulates TLR4-induced TNF and IL-6 production via AP-1.
21993313 2012 Regulation of the hematopoietic cell kinase (HCK) by PML/RAR? and PU.1 in acute promyelocytic leukemia.
21878628 2011 Hck is a key regulator of gene expression in alternatively activated human monocytes.
21625496 2011 Molecular design, functional characterization and structural basis of a protein inhibitor against the HIV-1 pathogenicity factor Nef.
21567396 2012 HIV-1 Nef perturbs the function, structure, and signaling of the Golgi through the Src kinase Hck.
21477083 2011 Conformation of the dileucine-based sorting motif in HIV-1 Nef revealed by intermolecular domain assembly.
21338576 2011 Protein tyrosine kinases in neutrophil activation and recruitment.
20810664 2010 Crystal structure of the Src family kinase Hck SH3-SH2 linker regulatory region supports an SH3-dominant activation mechanism.
20798061 2010 Multidomain assembled states of Hck tyrosine kinase in solution.
20670214 2010 Identification and biophysical assessment of the molecular recognition mechanisms between the human haemopoietic cell kinase Src homology domain 3 and ALG-2-interacting protein X.
20488787 2010 HIV-1 Nef triggers macrophage fusion in a p61Hck- and protease-dependent manner.
20452982 2010 Expression of a Src family kinase in chronic myelogenous leukemia cells induces resistance to imatinib in a kinase-dependent manner.
20181660 2010 Hematopoietic cell kinase associates with the 40S ribosomal subunit and mediates the ribotoxic stress response to deoxynivalenol in mononuclear phagocytes.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19903482 2010 c-Abl and Src-family kinases cross-talk in regulation of myeloid cell migration.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19718658 2009 Alternative splicing of ADAM15 regulates its interactions with cellular SH3 proteins.
19585521 2009 Dys-regulated activation of a Src tyroine kinase Hck at the Golgi disturbs N-glycosylation of a cytokine receptor Fms.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19234535 2009 Src kinase Hck association with the WASp and mDia1 cytoskeletal regulators promotes chemoattractant-induced Hck membrane targeting and activation in neutrophils.
19211505 2009 Identification of tyrosine kinase, HCK, and tumor suppressor, BIN1, as potential mediators of AHI-1 oncogene in primary and transformed CTCL cells.
19114024 2009 The oncogenic activity of the Src family kinase Hck requires the cooperative action of the plasma membrane- and lysosome-associated isoforms.
18794796 2008 An inhibitor-resistant mutant of Hck protects CML cells against the antiproliferative and apoptotic effects of the broad-spectrum Src family kinase inhibitor A-419259.
18538446 2008 Hematopoietic cell kinase (Hck) isoforms and phagocyte duties - from signaling and actin reorganization to migration and phagocytosis.
17893228 2008 Interaction between Hck and HIV-1 Nef negatively regulates cell surface expression of M-CSF receptor.
17668209 2007 Src family tyrosine kinases phosphorylate Flt3 on juxtamembrane tyrosines and interfere with receptor maturation in a kinase-dependent manner.
17535448 2007 Regulation of p73 by Hck through kinase-dependent and independent mechanisms.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17310994 2007 Inhibition of IL-6-dependent growth of myeloma cells by an acidic peptide repressing the gp130-mediated activation of Src family kinases.
17141806 2007 Solution structure of a Hck SH3 domain ligand complex reveals novel interaction modes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17024369 2007 Association of Hck genetic polymorphisms with gene expression and COPD.
16997556 2006 The development of 2-benzimidazole substituted pyrimidine based inhibitors of lymphocyte specific kinase (Lck).
16921024 2006 Differential kinase requirements in human and mouse Fc-gamma receptor phagocytosis and endocytosis.
16849330 2006 HIV-1 Nef selectively activates Src family kinases Hck, Lyn, and c-Src through direct SH3 domain interaction.
16636290 2006 Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
16374509 2006 Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16271895 2005 The N-terminal end of the catalytic domain of SRC kinase Hck is a conformational switch implicated in long-range allosteric regulation.
16216497 2006 Discovery of A-770041, a src-family selective orally active lck inhibitor that prevents organ allograft rejection.
16210316 2005 Activation of the Src family kinase Hck without SH3-linker release.
15998323 2005 Activation of the lysosome-associated p61Hck isoform triggers the biogenesis of podosomes.
15952790 2005 Identification of tyrosine residues on ELMO1 that are phosphorylated by the Src-family kinase Hck.
15784897 2005 Further studies on hepatitis C virus NS5A-SH3 domain interactions: identification of residues critical for binding and implications for viral RNA replication and modulation of cell signalling.
15626739 2005 HIV-1 Nef interferes with M-CSF receptor signaling through Hck activation and inhibits M-CSF bioactivities.
15491611 2004 Conserved residues in the HIV-1 Nef hydrophobic pocket are essential for recruitment and activation of the Hck tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15263807 2004 Expression of splice variants of the human ADAM15 gene and strong interaction between the cytoplasmic domain of one variant and Src family proteins Lck and Hck.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15010462 2004 Critical role for hematopoietic cell kinase (Hck)-mediated phosphorylation of Gab1 and Gab2 docking proteins in interleukin 6-induced proliferation and survival of multiple myeloma cells.
14993658 2004 The hepatitis C virus NS5A protein binds to members of the Src family of tyrosine kinases and regulates kinase activity.
14969582 2004 SRC-dependent outside-in signalling is a key step in the process of autoregulation of beta2 integrins in polymorphonuclear cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551213 2003 Constitutively active Galpha16 stimulates STAT3 via a c-Src/JAK- and ERK-dependent mechanism.
14551197 2003 Physical and functional interaction between Hck tyrosine kinase and guanine nucleotide exchange factor C3G results in apoptosis, which is independent of C3G catalytic domain.
12900520 2003 CSF-induced and HIV-1-mediated distinct regulation of Hck and C/EBPbeta represent a heterogeneous susceptibility of monocyte-derived macrophages to M-tropic HIV-1 infection.
12769846 2003 Contingent phosphorylation/dephosphorylation provides a mechanism of molecular memory in WASP.
12748290 2003 Two distinct phosphorylation pathways have additive effects on Abl family kinase activation.
12734187 2003 Src-CrkII-C3G-dependent activation of Rap1 switches growth hormone-stimulated p44/42 MAP kinase and JNK/SAPK activities.
12626508 2003 Hypertonicity activates Na+/H+ exchange through Janus kinase 2 and calmodulin.
12600646 2003 The role of Vif during HIV-1 infection: interaction with novel host cellular factors.
12592324 2003 The interaction of the Bcr-Abl tyrosine kinase with the Src kinase Hck is mediated by multiple binding domains.
12576423 2003 Tissue microarray analysis of signal transducers and activators of transcription 3 (Stat3) and phospho-Stat3 (Tyr705) in node-negative breast cancer shows nuclear localization is associated with a better prognosis.
12538589 2003 Regulation of a transient receptor potential (TRP) channel by tyrosine phosphorylation. SRC family kinase-dependent tyrosine phosphorylation of TRPV4 on TYR-253 mediates its response to hypotonic stress.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12496276 2003 Identification of UNC119 as a novel activator of SRC-type tyrosine kinases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411494 2002 The Src family kinase Hck couples BCR/ABL to STAT5 activation in myeloid leukemia cells.
12244095 2002 Activation of STAT3 by the Src family kinase Hck requires a functional SH3 domain.
12235133 2002 Phosphorylation of tyrosine 291 enhances the ability of WASp to stimulate actin polymerization and filopodium formation. Wiskott-Aldrich Syndrome protein.
12181444 2002 Activation of phospholipase Cgamma2 by tyrosine phosphorylation.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11994282 2002 Inhibition of Src family kinases blocks epidermal growth factor (EGF)-induced activation of Akt, phosphorylation of c-Cbl, and ubiquitination of the EGF receptor.
11976726 2002 SH3-dependent stimulation of Src-family kinase autophosphorylation without tail release from the SH2 domain in vivo.
11940572 2002 ErbB-2 activates Stat3 alpha in a Src- and JAK2-dependent manner.
11904303 2002 p59Hck isoform induces F-actin reorganization to form protrusions of the plasma membrane in a Cdc42- and Rac-dependent manner.
11896602 2002 Membrane-anchored Cbl suppresses Hck protein-tyrosine kinase mediated cellular transformation.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11741929 2002 Phosphorylation-dependent interactions between ADAM15 cytoplasmic domain and Src family protein-tyrosine kinases.
11689697 2001 Signaling through a novel domain of gp130 mediates cell proliferation and activation of Hck and Erk kinases.
11518702 2001 The ORF3 protein of hepatitis E virus binds to Src homology 3 domains and activates MAPK.
11500821 2001 Hck SH3 domain-dependent abrogation of Nef-induced class 1 MHC down-regulation.
11350938 2001 Protein kinase PKR is required for platelet-derived growth factor signaling of c-fos gene expression via Erks and Stat3.
11294897 2001 Identification of tyrosine residues in constitutively activated fibroblast growth factor receptor 3 involved in mitogenesis, Stat activation, and phosphatidylinositol 3-kinase activation.
11278465 2001 The tyrosine kinase Hck is an inhibitor of HIV-1 replication counteracted by the viral vif protein.
11239464 2001 RING finger mutations that abolish c-Cbl-directed polyubiquitination and downregulation of the EGF receptor are insufficient for cell transformation.
11097855 2000 Soluble urokinase receptor promotes cell adhesion and requires tyrosine-92 for activation of p56/59(hck).
11071635 2000 Stem cell factor induces phosphatidylinositol 3'-kinase-dependent Lyn/Tec/Dok-1 complex formation in hematopoietic cells.
10973280 2000 Regulation of tyrosine kinase activation and granule release through beta-arrestin by CXCRI.
10967098 2000 Lack of palmitoylation redirects p59Hck from the plasma membrane to p61Hck-positive lysosomes.
10934191 2000 Modulation of the catalytic activity of the Src family tyrosine kinase Hck by autophosphorylation at a novel site in the unique domain.
10918587 2000 Transformation and Stat activation by derivatives of FGFR1, FGFR3, and FGFR4.
10861086 2000 Differential involvement of Src family kinases in Fc gamma receptor-mediated phagocytosis.
10858437 2000 Collagen, convulxin, and thrombin stimulate aggregation-independent tyrosine phosphorylation of CD31 in platelets. Evidence for the involvement of Src family kinases.
10849448 2000 Transformation of myeloid leukemia cells to cytokine independence by Bcr-Abl is suppressed by kinase-defective Hck.
10799548 2000 Hck enhances the adherence of lipopolysaccharide-stimulated macrophages via Cbl and phosphatidylinositol 3-kinase.
10779760 2000 IL-2 signaling in human monocytes involves the phosphorylation and activation of p59hck.
10749872 2000 Characterization of the human B cell RAG-associated gene, hBRAG, as a B cell receptor signal-enhancing glycoprotein dimer that associates with phosphorylated proteins in resting B cells.
10644735 2000 Reciprocal regulation of Hck activity by phosphorylation of Tyr(527) and Tyr(416). Effect of introducing a high affinity intramolecular SH2 ligand.
10586033 1999 Regulated association between the tyrosine kinase Emt/Itk/Tsk and phospholipase-C gamma 1 in human T lymphocytes.
10527858 1999 Novel association of the src family kinases, hck and c-fgr, with CCR3 receptor stimulation: A possible mechanism for eotaxin-induced human eosinophil chemotaxis.
10360180 1999 Crystal structure of Hck in complex with a Src family-selective tyrosine kinase inhibitor.
10318861 1999 Activation of C3G guanine nucleotide exchange factor for Rap1 by phosphorylation of tyrosine 504.
10092522 1999 The proto-oncogene p120(Cbl) is a downstream substrate of the Hck protein-tyrosine kinase.
10068673 1999 Involvement of wiskott-aldrich syndrome protein in B-cell cytoplasmic tyrosine kinase pathway.
9890970 1999 Fyn associates with Cbl and phosphorylates tyrosine 731 in Cbl, a binding site for phosphatidylinositol 3-kinase.
9837776 1998 RA70 is a src kinase-associated protein expressed ubiquitously.
9790917 1998 The Src-like tyrosine kinase Hck is activated by granulocyte colony-stimulating factor (G-CSF) and docks to the activated G-CSF receptor.
9778343 1998 RT loop flexibility enhances the specificity of Src family SH3 domains for HIV-1 Nef.
9742969 1998 Tyrosine phosphorylation of the Wiskott-Aldrich syndrome protein by Lyn and Btk is regulated by CDC42.
9571048 1998 Solution structure of the human Hck SH3 domain and identification of its ligand binding site.
9407116 1997 The Src family kinase Hck interacts with Bcr-Abl by a kinase-independent mechanism and phosphorylates the Grb2-binding site of Bcr.
9406996 1997 Signal transduction of interleukin-6 involves tyrosine phosphorylation of multiple cytosolic proteins and activation of Src-family kinases Fyn, Hck, and Lyn in multiple myeloma cell lines.
9400828 1997 Bacterial LPS and IFN-gamma trigger the tyrosine phosphorylation of vav in macrophages: evidence for involvement of the hck tyrosine kinase.
9268059 1997 Influence of tyrosine phosphorylation on protein interaction with FcgammaRIIa.
9218412 1997 SH3-mediated Hck tyrosine kinase activation and fibroblast transformation by the Nef protein of HIV-1.
9195918 1997 Binding of src-like kinases to the beta-subunit of the interleukin-3 receptor.
9178913 1997 Bcr phosphorylated on tyrosine 177 binds Grb2.
9109402 1997 Sequential assignment and secondary structure determination for the Src homology 2 domain of hematopoietic cellular kinase.
9024658 1997 Crystal structure of the Src family tyrosine kinase Hck.
9020138 1997 Involvement of p130(Cas) and p105(HEF1), a novel Cas-like docking protein, in a cytoskeleton-dependent signaling pathway initiated by ligation of integrin or antigen receptor on human B cells.
8995234 1997 Hck is activated by opsonized zymosan and A23187 in distinct subcellular fractions of human granulocytes.
8955135 1996 Co-expression with BCR induces activation of the FES tyrosine kinase and phosphorylation of specific N-terminal BCR tyrosine residues.
8885868 1996 Protein kinase C mu (PKC mu) associates with the B cell antigen receptor complex and regulates lymphocyte signaling.
8657103 1996 Phospholipase C-gamma1 interacts with conserved phosphotyrosyl residues in the linker region of Syk and is a substrate for Syk.
8626374 1996 Dominant negative stat3 mutant inhibits interleukin-6-induced Jak-STAT signal transduction.
8132624 1994 Physical and functional association of Src-related protein tyrosine kinases with Fc gamma RII in monocytic THP-1 cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8064233 1994 Physical and functional association of the high affinity immunoglobulin G receptor (Fc gamma RI) with the kinases Hck and Lyn.
8058772 1994 Binding of Bruton's tyrosine kinase to Fyn, Lyn, or Hck through a Src homology 3 domain-mediated interaction.
7859737 1995 Proline-rich (PxxP) motifs in HIV-1 Nef bind to SH3 domains of a subset of Src kinases and are required for the enhanced growth of Nef+ viruses but not for down-regulation of CD4.
7791757 1995 Myristoylation and differential palmitoylation of the HCK protein-tyrosine kinases govern their attachment to membranes and association with caveolae.
7782336 1995 The Ras GTPase-activating protein (GAP) is an SH3 domain-binding protein and substrate for the Src-related tyrosine kinase, Hck.
7682059 1993 In vitro tyrosine phosphorylation of PLC-gamma 1 and PLC-gamma 2 by src-family protein tyrosine kinases.
7535819 1995 The Fc gamma RI receptor signals through the activation of hck and MAP kinase.
3496523 1987 Identification of a human gene (HCK) that encodes a protein-tyrosine kinase and is expressed in hemopoietic cells.
3453117 1987 Novel protein-tyrosine kinase gene (hck) preferentially expressed in cells of hematopoietic origin.
1875927 1991 Two isoforms of murine hck, generated by utilization of alternative translational initiation codons, exhibit different patterns of subcellular localization.
1720539 1991 Two additional protein-tyrosine kinases expressed in human lung: fourth member of the fibroblast growth factor receptor family and an intracellular protein-tyrosine kinase.
1689310 1990 Tyrosine residues in bovine phospholipase C-gamma phosphorylated by the epidermal growth factor receptor in vitro.
1572549 1992 The genomic locus of the human hemopoietic-specific cell protein tyrosine kinase (PTK)-encoding gene (HCK) confirms conservation of exon-intron structure among human PTKs of the src family.
1373873 1992 Human protein-tyrosine kinase gene HCK: expression and structural analysis of the promoter region.