Property Summary

NCBI Gene PubMed Count 153
PubMed Score 404.41
PubTator Score 381.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (146)

PMID Text
27295912 Urinary KIM1 is significantly higher in patients with clear cell renal carcinoma than in controls. Urinary KIM1 decreases after nephrectomy in clear cell renal carcinoma patients.
27049082 decreased serum TIM-1 and TIM-3 levels and association of TIM-3 with nephritis suggest their possible role in the development and pathogenesis of systemic lupus erythematosus.
26921445 Activation of TIM1 by exposing the cells to TIM4 significantly increased the frequency of apoptotic colon cancer cells. The expression of FasL was increased in the cancer cells after treating by TIM4.
26751954 Urinary VDBP and KIM-1 are potent new biomarkers of major adverse renal events in patients undergoing coronary angiography.
26697493 The aim of this review article is to summarize the literature data concerning KIM-1 as a potential novel marker in the early diagnosis and prediction of clinical outcome of certain cardiovascular diseases.
26673824 Data show that kidney injury molecule (KIM)-1 and neutrophil gelatinase-associated lipocalin (NGAL), were significantly elevated in welding workers post-exposure.
26575624 Phosphatidylethanolamine plays a key role in TIM1-mediated virus entry.
26407192 Urine KIM1 level was higher in kidney stone patients before lithotripsy than in healthy controls.
26393328 High NGAL and KIM-1 levels may indicate early diabetic kidney injury; however, we did not observe any relationship between these markers and diabetic indices
26332704 TIM-1 ligands increase the amount of cell surface protein, preventing its traffic to the immune synapse
26324091 Urinary levels of NGAL are more sensitive than uKIM-1 and uL-FABP levels in predicting renal scarring in vesicoureteral reflux.
26282792 KIM-1-/TIM-1-mediated phagocytosis links ATG5-/ULK1-dependent clearance of apoptotic cells to antigen presentation.
26248472 Urinary KIM-1 measured 24 h after the start of drug infusion has the potential to detect early AKI in pediatric patients treated with MTX or platinum-class drugs
26125859 there was no significant differ-ence in TIM-1 mRNA expression between the patients and the healthy controls. Our results suggest that insufficient expression of TIM-3 mRNA may be involved in the pathogenesis of nephropathy
26107391 Urinary KIM-1 is a significant predictor of death in extremely low-birth-weight neonates.
26041148 Our results suggest that -416 G>C polymorphism in TIM-1 gene could be a predisposing factor for atopic asthma in Iranian population
25989460 Serial uKIM-1 measurement can be used as non-invasive diagnostic biomarkers to predict delayed graft function in living donor renal transplant recipients.
25899833 TIM-4 rs7700944 and not TIM-1 rs41297579 G>A (-1454) is associated with rheumatoid arthritis(RA) in the present cohort of Egyptian and may be a risk factor for development of RA in Egyptian.
25895828 Following ICU admission, urinary levels of KIM-1 increase in patients with acute kidney injury.
25884518 KIM-1 gene expression represent a potential biomarker of kidney allograft fibrosis.
25762211 Kidney injury molecule-1 and neutrophil gelatinase-associated lipocalin excretion rates correlated with excretion rates of other tubular damage markers and predicted outcome in patients with idiopathic membranous nephropathy
25618270 thus, urinary Kidney Injury Molecule-1 levels may be useful in tracking the progression of kidney disease.
25331534 TIM1 -1454G>A polymorphism provides resistance toward asthma in North Indian population.
25195004 KIM-1 and NGAL are considered excellent biomarkers in urine and plasma for the early prediction of acute kidney injury. (Review)
25154466 early urinary biomarker in the diagnosis of septic acute kidney injury
25152377 Results from the meta-analysis suggested that TIM-1 5383_5397 insertion/deletion may not substantially contribute to asthma susceptibility. However, gene-gene and gene-environment interactions and other considerations involving this polymorphism may exit.
25136083 Our study uncovers a novel ability of TIM-family proteins to block the release of HIV-1 and other viruses by interaction with virion- and cell-associated phosphatidylserine.
25136083 TIM-1 mutants N114A, D115A, and ND114/115AA exhibit a significantly decreased ability to inhibit HIV-1 release in terms of CA levels compared with wild-type TIM-1 in 293T cells
25063374 Albumin and glycated albumin activate KIM-1 release in tubular epithelial cells through distinct kinetics and mechanisms
24998891 High urinary KIM-1 is related to relatively severe pathologic involvement in IgA nephropathy and mild proteinuria.
24958504 Data indicate that among subjects with severe preeclampsia, urinary excretion of complement activation products correlated most closely with kidney injury molecule-1 (KIM-1).
24923577 Higher urinary KIM-1 may predispose to a higher risk of cardiovascular mortality independently of established cardiovascular risk factors, eGFR, and albuminuria.
24904085 blood biomarker that specifically reflects acute and chronic kidney injury
24829508 KIM-1 shedding is accelerated by worsening renal cellular injury, and excess soluble KIM-1 competitively inhibits efferocytosis.
24801162 High urine Kim-1 levels are associated with acute kidney injury.
24696470 Neither the cytoplasmic nor the transmembrane domain of TIM-1 is essential for enhancing virus entry.
24687388 Data suggest up-regulation of urinary levels of KIM1, NGAL (neutrophil gelatinase associated lipocalin), and LFABP (liver fatty acid-binding protein) can be used as biomarkers to reflect tubular dysfunction in early-stage type 2 diabetic nephropathy.
24652046 Kidney injury molecule-1 is involved in the chemotactic migration of mesenchymal stem cells.
24523388 tubular cells with KIM-1 expression can regulate the immune response of inflammatory cells through the secretion of chemotactic factors.
24438875 High urinary KIM-1 expression is associated with insulin resistance.
24412470 The ratio of Tim-3 to Tim-1 in patients with active disease was significantly decreased compared with the ratios in the normal group and in the immune thrombocytopenia patients in remission.
24404151 Urinary KIM-1 may be a promising biomarker for early detection of AKI with considerable predictive value, especially for cardiac surgery patients.
24390735 HAVCR/KIM-1 activates the IL-6/STAT-3/HIF-1A axis.
24384771 There was no significant difference in KIM-1 levels in diabetics than in non-diabetics.
24375576 NGAL, IL-18, KIM-1, L-FABP, and albumin differed between etiologies and were significantly higher in patients adjudicated with acute kidney injury.
24321290 NGAL, KIM-1, pi- and alpha-GST displayed unique and mutually incomparable time dependent characteristics during the development of non-sepsis related AKI.
24286866 TIM-1 and TIM-4 are novel targets for ADAM10- and ADAM17-mediated ectodomain shedding.
24165570 Urinary KIM-1 and NGAL had a good accuracy for detecting acute kidney injury in obstructive nephropathy.
24158981 KIM-1 expression increased significantly in a manner that corresponded temporally and regionally with increased phosphorylation of checkpoint kinase 1 (Chk1) and STAT3 in acute kidney injury.
24054338 Urinary KIM-1 is a modest predictor of acute kidney injury in acute decompensated heart failure.
24044353 High KIM1 expression is associated with acute kidney injury.
23964107 The HAVCR1 genomic region is an independent genetic determinant of hepatitis C virus persistence in individuals of African descent.
23936859 Accuracy of KIM-1 in screening of AKI development in children with urinary tract infection is low.
23837450 In patients with IgA nephropathy, treatment reduced the urinary levels of KIM-1.
23698310 These results provide evidence for a broad role of TIM-1 as a phosphatidylserine-binding receptor that mediates enveloped-virus uptake.
23673972 male, obese, hypertensive adolescents with hyperuricemia have higher urine NGAL and KIM-1 levels
23599408 Postoperative elevations of KIM-1 associate with acute kidney injury and adverse outcomes in adults but were not independent of other AKI biomarkers.
23435265 An optimal predictive model was built by combining KIM-1 on the 1st day.
23352434 Data indicate that constitutive expression of HAVCR/KIM-1 in kidney might constitute a susceptibility trait for clear cell renal cell carcinoma (ccRCC) tumour development.
23267147 HAVcR-1 overexpression can reduce cell adhesion and invasion and could thus be involved in the metastatic cascade.
23233528 TIM1 and other TIM family proteins promote the lysosomal degradation of the nuclear receptor NUR77.
23220501 The TIM1 haplotype diversity showed no association with susceptibility to HIV-1 infection.
23135864 Tissue KIM-1 expression is an independent predictor of adverse renal outcomes in IgA nephropathy patients
23026578 Data suggests that KIM-1 gene mRNA quantification can be used as a noninvasive biomarker of interstitral fibrosis/tubular atrophy in kidney transplant recipients.
22984472 These studies are the first direct demonstration of regulation of KIM-1 in response to oxalate exposure in renal epithelial cells in vitro and in vivo.
22857392 the -416G>C polymorphism of the TIM-1 gene is associated with childhood allergic asthma.
22843853 The results suggest that kidney injury molecule-1 (KIM-1) negatively regulates cellular function mediated through interaction with collagen, and MT1-MMP abrogates it through the cleavage and shedding of KIM-1.
22749388 Urinary marker KIM-1 level is associated with risk of kidney disease independent of albuminuria.
22710823 Data suggest that T-cell immunoglobulin domain and mucin domain containing protein 1 (TIM1) to be under positive natural selection in primates.
22709877 FG-CC' siRNA blocking interaction of Tim-1 and Tim-4 can enhance dendritic cell vaccine activity against gastric cancer.
22515481 Studies indicate the most studied biomarkers for acute kidney injury are neutrophil gelatinase-associated lipocalin-2, kidney injury molecule-1, IL-18, cystatin C, N-acetyl-beta-D-glucosaminidase, liver fatty-acid binding protein, and heat shock protein 72.
22495365 PAX-2, PAX-8, and hKIM-1 should be used cautiously in distinguishing renal cell carcinoma from nonseminomatous germ cell neoplasia and also adds to the growing list of nonrenal tumors that express these 3 markers.
22484054 in vitro and in vivo evidences suggest that MMP-3 plays an inductive role in KIM-1 shedding by PTEC
22290466 -1637A>G and -232A>G polymorphisms of TIM-1 are associated with susceptibility to rheumatoid arthritis in the Chinese Hui population.
22190394 Different rates of infection by viral genotypes were observed among the HAVCR1 haplotypes in a Spanish population.
22080624 Results showed that Tim1 mRNA expression was significantly higher in Henoch Schonlein purpura patients, which was closely correlated with serum TNFa, IL4 levels, IgA1 levels.
21996225 heart transplantation is associated with kidney injury as reflected by elevated urinary KIM-1 and reduced eGFR
21723753 Studies indicate that molecular markers, such as cystatin C, neutrophil gelatinase-associated lipocalin (NGAL), IL-18 and kidney injury molecule-1 (KIM-1), better quantify the extent of acute ischemic and/or tubular injury than other available tools.
21536871 TIM-1 serves as a receptor for filoviruses on mucosal epithelia from the trachea, cornea, and conjunctiva--tissues believed to be important during in vivo transmission of filoviruses
21513984 Tim-1 is a transmembrane protein expressed on activated lymphocytes and appears to have a role as a co-stimulatory receptor in T cells. Tim-1 is phosphorylated in B cells and interacts with Fyn. Fyn is required for phosphorylation of Tim-1 in B cells.
21467131 High urinary excretion of kidney injury molecule-1 is associated with end-stage renal disease in patients with IgA nephropathy
21402675 High KIM-1 is associated with kidney injury in IgA nephropathy.
21378325 HAVcR-1 may have a novel function as part of the regulatory apparatus for TJ in human endothelial cells.
21367814 The findings suggest that the polymorphisms of TIM gene family might not contribute to systemic lupus erythematosus susceptibility in the Chinese population.
21339644 a TIM1 polymorphism is associated with susceptibility to severe hepatitis A virus infection in humans
20980978 lower urinary KIM-1 and NAG levels were associated with the regression of microalbuminuria in type 1 diabetes mellitus
20972250 Observational study of gene-disease association. (HuGE Navigator)
20819195 Significant upregulation of LCN2 and HAVCR1 could be detected in the delayed kidney graft funtion group. Prognostic value of the two biomarkers together with donor age ranges between 75% and 83%.
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20549518 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20479636 TIM1 D3-A haplotype is associated with the delay of disease progression to AIDS in the HIV-1 infected Thai females.
20479636 Observational study of gene-disease association. (HuGE Navigator)
20447817 KIM-1 is expected to be a therapeutic target for kidney injury
20388397 KIM-1 is a specific biomarker for injuried kidney proximal tubules and the corresponding neoplasms, and has a high specificity and sensitivity for primary or metastatic clear cell renal cell carcinomas.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20304168 KIM-1 mRNA may be useful biomarker of tubular damage associated with calcineurin inhibitor nephrotoxicity nd tubular atrophy in kidney transplantation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233133 urinary KIM-1 is a associated acute kidney injury
20232767 TIM-1 gene polymorphisms (-416G>C and -1454G>A) are associated with allergic rhinitis susceptibility in a Han Chinese population.
20232767 Observational study of gene-disease association. (HuGE Navigator)
20070602 Observational study of gene-disease association. (HuGE Navigator)
19572801 KIM-1 performed best as an early biomarker for acute kidney injury
19522876 Kim-1 is a promising novel marker for the early, organ specific and noninvasive detection of brain death-induced donor kidney damage.
19494522 haplotypes including TIM-1 genetic variants confer susceptibility to asthma in a Chinese population
19494522 Observational study of gene-disease association. (HuGE Navigator)
19480659 First data on the expression of TIM-1 molecules in sarcoidosis.
19476019 gene polymorphism is associated with elevated serum total IgE levels, particularly in individuals with atopic asthma in middle China
19476019 Observational study of gene-disease association. (HuGE Navigator)
19424017 Blocking the TIM-1 pathway is now emerging as a successful strategy to promote experimental peripheral transplantation tolerance.
19387469 Dipsticks can provide a sensitive and accurate detection of HAVCR1.
19264973 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19173034 KIM-1 can be used as human urinary renal dysfunction biomarker.
19167431 negative association between Hepatitis A virus seropositivity and atopic disease
18802347 For humans, carriers of particular Tim-1 alleles, infection with hepatitis A virus (binds to Tim-1)protects from atopy
18769021 KIM-1 has a role in the clearance of debris from damaged renal tubules in acute kidney injury.
18715847 Upregulation of kidney injury molecule-1 (KIM-1), a specific injury marker, is demonstrated in proximal tubular cells in urate nephropathy.
18466531 Observational study of gene-disease association. (HuGE Navigator)
18453570 a pathway from Tim-1 tyrosine phosphorylation to the PI3K signaling pathway appears to be a major effector of Tim-1-mediated T cell activation
18294362 The present results suggest that the higher TIM1 expression associated with the protective TIM1 promoter haplotype confers protection against cerebral malaria.
18294362 Observational study of gene-disease association. (HuGE Navigator)
18273441 identify Kim1 as an endogenous ciliary protein
18165774 Urinary excretion of KIM-1 is an independent predictor of long-term graft loss after kidney transplantation.
18082433 TIM-4 and TIM-1 are immunologically restricted members of the group of receptors whose recognition of PS is critical for the efficient clearance of apoptotic cells and prevention of autoimmunity.
18052965 Involved in the pathogenesis of systemic lupus erythematosus.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17570927 Observational study of gene-disease association. (HuGE Navigator)
17570927 A variation site in the TIM-1 promoter region is associated with asthma susceptibility in a Chinese Han population.
17371991 TIM-1 is a critical component of the human T cell response and provide a mechanistic hypothesis for the role of TIM-1 in disease.
17229699 IgA1lambda is a specific ligand of HAVCR1/TIM1 and that their association has a synergistic effect in virus-receptor interactions
17205356 Kim1 is a novel regulatory molecule of flow-induced calcium signaling in kidney cells
17117951 Observational study of gene-disease association. (HuGE Navigator)
16940744 Observational study of gene-disease association. (HuGE Navigator)
16481347 co-immobilized recombinant eTim-1 was able to inhibit T cell activation mediated by CD3 + CD28 mAb
15867855 Observational study of gene-disease association. (HuGE Navigator)
15300647 The two polymorphism sites of TIM-1 are not associated with allergic asthma in Chinese children.
15086915 is expressed at higher levels in clear cell renal cell carcinoma
15007635 Review discusses recent studies demonstrating that the TIM family, particularly TIM-1, plays a critical role in immune responses that regulate the development of atopic diseases.
14637143 Our results strongly suggest that the 5383_5397del variation site of Tim-1 exon 4 might be associated with atopic dermatitis susceptibility.
14630400 The exon 4 variation site in human Tim-1 gene is associated with the susceptibility to allergic disease
14534576 protective effects of hepatitis A virus on atopic disease depends on a common TIM-1 allele
12618867 Polymorphisms in hHAVcr-1 are not associated with atopic asthma in the Japanese population.
12138159 shedding of KIM-1 in the regenerating kidney constitutes an active mechanism allowing dedifferentiated regenerating cells to scatter on basement membrane and reconstitute a continuous epithelial layer
11725301 asthma susceptibility gene

AA Sequence

MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT      1 - 70
YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT     71 - 140
VTTVRTSTTVPTTTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPM    141 - 210
PLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEH    211 - 280
SLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQAEDNIY    281 - 350
IENSLYATD                                                                 351 - 359
//

Text Mined References (157)

PMID Year Title
27295912 2016 Urinary KIM-1 and AQP-1 in patients with clear renal cell carcinoma: Potential noninvasive biomarkers.
27049082 Decreased serum levels of T-cell immunoglobulin mucin-1 and T-cell immunoglobulin mucin-3 in systemic lupus erythematosus patients.
26921445 2016 Activation of TIM1 induces colon cancer cell apoptosis via modulating Fas ligand expression.
26751954 2016 Urinary Vitamin D Binding Protein and KIM-1 Are Potent New Biomarkers of Major Adverse Renal Events in Patients Undergoing Coronary Angiography.
26697493 2015 Kidney Injury Molecule-1 and Cardiovascular Diseases: From Basic Science to Clinical Practice.
26673824 2015 Urinary neutrophil gelatinase-associated lipocalin is associated with heavy metal exposure in welding workers.
26575624 2015 Virion-associated phosphatidylethanolamine promotes TIM1-mediated infection by Ebola, dengue, and West Nile viruses.
26407192 2016 The Application of Kidney Injury Molecule-1 to Determine the Duration Between Shockwave Lithotripsy Sessions.
26393328 2016 Kidney injury molecule-1 and neutrophil gelatinase associated lipocalin in normoalbuminuric diabetic children.
26332704 2015 Distinct Trafficking of Cell Surface and Endosomal TIM-1 to the Immune Synapse.
26324091 2016 Role of new biomarkers for predicting renal scarring in vesicoureteral reflux: NGAL, KIM-1, and L-FABP.
26282792 2015 KIM-1-/TIM-1-mediated phagocytosis links ATG5-/ULK1-dependent clearance of apoptotic cells to antigen presentation.
26248472 2015 Urinary KIM-1 in children undergoing nephrotoxic antineoplastic treatment: a prospective cohort study.
26125859 2015 Decreased TIM-3 mRNA expression in peripheral blood mononuclear cells from nephropathy patients.
26107391 2015 Urinary kidney injury molecule-1 rapid test predicts acute kidney injury in extremely low-birth-weight neonates.
26041148 2015 Association analysis of -416 G>C polymorphism of T-cell immunoglobulin and mucin domain-1 gene with asthma in Iran.
25989460 2015 Urinary Kidney injury molecule-1 can predict delayed graft function in living donor renal allograft recipients.
25899833 2015 TIM-1 rs41297579 G>A (-1454) and TIM-4 rs7700944 gene polymorphisms as possible risk factor for rheumatoid arthritis: relation to activity and severity.
25895828 2015 Urinary neutrophil gelatinase-associated lipocalin identifies critically ill young children with acute kidney injury following intensive care admission: a prospective cohort study.
25884518 2015 Kidney injury molecule-1 expression in human kidney transplants with interstitial fibrosis and tubular atrophy.
25855742 2015 Interaction between TIM-1 and NPC1 Is Important for Cellular Entry of Ebola Virus.
25762211 2016 Kidney injury molecule-1 and neutrophil gelatinase-associated lipocalin as prognostic markers in idiopathic membranous nephropathy.
25702396 2014 [Role of kidney injury molecule-1 (KIM-1) for inhospital event risk assessment after coronary artery bypass surgery].
25618270 2014 Evaluation of the urinary kidney injury molecule-1 levels in patients with diabetic nephropathy.
25331534 2015 Protective association of TIM1-1454G>a polymorphism with asthma in a North Indian population.
25195004 2015 Biomarkers of renal function, which and when?
25154466 2014 Urinary netrin-1 and KIM-1 as early biomarkers for septic acute kidney injury.
25152377 2014 Pooled-analysis of the association between TIM-1 5383_5397 insertion/deletion polymorphism and asthma susceptibility.
25136083 2014 TIM-family proteins inhibit HIV-1 release.
25063374 2014 Albumin and glycated albumin activate KIM-1 release in tubular epithelial cells through distinct kinetics and mechanisms.
24998891 2014 Urinary kidney injury molecule-1 is related to pathologic involvement in IgA nephropathy with normotension, normal renal function and mild proteinuria.
24958504 2014 Complement activation and kidney injury molecule-1-associated proximal tubule injury in severe preeclampsia.
24923577 2014 Urinary kidney injury molecule-1 and the risk of cardiovascular mortality in elderly men.
24904085 2014 Blood kidney injury molecule-1 is a biomarker of acute and chronic kidney injury and predicts progression to ESRD in type I diabetes.
24829508 2014 Accelerated receptor shedding inhibits kidney injury molecule-1 (KIM-1)-mediated efferocytosis.
24801162 2014 Urinary biomarkers of acute kidney injury in deceased organ donors--kidney injury molecule-1 as an adjunct to predicting outcome.
24696470 2014 Characterizing functional domains for TIM-mediated enveloped virus entry.
24687388 2014 Nonalbuminuric proteinuria as a biomarker for tubular damage in early development of nephropathy with type 2 diabetic patients.
24652046 2014 Kidney injury molecule-1 is involved in the chemotactic migration of mesenchymal stem cells.
24523388 2014 Kidney injury molecule-1 expression in IgA nephropathy and its correlation with hypoxia and tubulointerstitial inflammation.
24438875 2014 Kidney injury molecule (KIM)-1 is associated with insulin resistance: results from two community-based studies of elderly individuals.
24412470 2014 Imbalanced expression of human Tim-1 and Tim-3 in peripheral blood mononuclear cells from immune thrombocytopenia patients.
24404151 2014 Diagnostic value of urinary kidney injury molecule 1 for acute kidney injury: a meta-analysis.
24390735 2014 HAVCR/KIM-1 activates the IL-6/STAT-3 pathway in clear cell renal cell carcinoma and determines tumor progression and patient outcome.
24384771 2013 Assessment of kidney function in diabetic patients. Is there a role for new biomarkers NGAL, cystatin C and KIM-1?
24375576 2014 Kidney biomarkers and differential diagnosis of patients with cirrhosis and acute kidney injury.
24321290 2013 Time of injury affects urinary biomarker predictive values for acute kidney injury in critically ill, non-septic patients.
24286866 2014 Soluble T cell immunoglobulin and mucin domain (TIM)-1 and -4 generated by A Disintegrin And Metalloprotease (ADAM)-10 and -17 bind to phosphatidylserine.
24165570 2014 Diagnostic performance of urinary kidney injury molecule-1 and neutrophil gelatinase-associated lipocalin for acute kidney injury in an obstructive nephropathy patient.
24158981 2014 A bioinformatics approach identifies signal transducer and activator of transcription-3 and checkpoint kinase 1 as upstream regulators of kidney injury molecule-1 after kidney injury.
24054338 2013 Novel urinary biomarkers in detecting acute kidney injury, persistent renal impairment, and all-cause mortality following decongestive therapy in acute decompensated heart failure.
24044353 2014 Antioxidant signal and kidney injury molecule-1 levels in shockwave lithotripsy induced kidney injury.
23964107 2014 Variants in HAVCR1 gene region contribute to hepatitis C persistence in African Americans.
23936859 2013 Clinical application neutrophil gelatinase-associated lipocalin and kidney injury molecule-1 as indicators of inflammation persistence and acute kidney injury in children with urinary tract infection.
23837450 2013 Effect of treatment on urinary kidney injury molecule-1 in IgA nephropathy.
23698310 2013 Role of the phosphatidylserine receptor TIM-1 in enveloped-virus entry.
23673972 2013 Urine NGAL and KIM-1 in children and adolescents with hyperuricemia.
23599408 2013 Performance of kidney injury molecule-1 and liver fatty acid-binding protein and combined biomarkers of AKI after cardiac surgery.
23555248 2013 TIM-family proteins promote infection of multiple enveloped viruses through virion-associated phosphatidylserine.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23435265 2013 Kidney injury molecule-1 and osteopontin: new markers for prediction of early kidney transplant rejection.
23352434 2013 Hepatitis A virus cellular receptor 1/kidney injury molecule-1 is a susceptibility gene for clear cell renal cell carcinoma and hepatitis A virus cellular receptor/kidney injury molecule-1 ectodomain shedding a predictive biomarker of tumour progression.
23267147 2013 HAVcR-1 expression in human colorectal cancer and its effects on colorectal cancer cells in vitro.
23233528 2012 TIM family proteins promote the lysosomal degradation of the nuclear receptor NUR77.
23220501 2013 Status of TIM-1 exon 4 haplotypes and CD4+T cell counts in HIV-1 seroprevalent North Indians.
23135864 2013 KIM-1 expression predicts renal outcomes in IgA nephropathy.
23084921 2012 The TIM and TAM families of phosphatidylserine receptors mediate dengue virus entry.
23026578 2012 Noninvasive analyses of kidney injury molecule-1 messenger RNA in kidney transplant recipients with graft dysfunction.
22984472 2012 Kidney injury molecule-1 is up-regulated in renal epithelial cells in response to oxalate in vitro and in renal tissues in response to hyperoxaluria in vivo.
22857392 2012 Association of Hepatitis A exposure and TIM-1 with childhood allergic asthma.
22843853 2012 Shedding of kidney injury molecule-1 by membrane-type 1 matrix metalloproteinase.
22749388 2012 Associations of urinary levels of kidney injury molecule 1 (KIM-1) and neutrophil gelatinase-associated lipocalin (NGAL) with kidney function decline in the Multi-Ethnic Study of Atherosclerosis (MESA).
22710823 2012 Lineage-specific evolution of T-cell immunoglobulin and mucin domain 1 gene in the primates.
22709877 A new development of FG-CC' siRNA blocking interaction of Tim-1 and Tim-4 can enhance DC vaccine against gastric cancer .
22515481 2012 Are recently reported biomarkers helpful for early and accurate diagnosis of acute kidney injury?
22495365 2012 Evaluation of putative renal cell carcinoma markers PAX-2, PAX-8, and hKIM-1 in germ cell tumors: a tissue microarray study of 100 cases.
22484054 2012 Distinct role of matrix metalloproteinase-3 in kidney injury molecule-1 shedding by kidney proximal tubular epithelial cells.
22290466 2012 Polymorphisms of the TIM-1 gene are associated with rheumatoid arthritis in the Chinese Hui minority ethnic population.
22190394 2012 HAVCR1 gene haplotypes and infection by different viral hepatitis C virus genotypes.
22080624 2012 T cell immunoglobulin and mucin-domain containing molecule 1 in peripheral blood mononuclear cells in Henoch Schonlein purpura.
21996225 2011 Kidney injury molecule-1 correlates with kidney function in heart allograft recipients.
21723753 2013 Molecular markers of kidney injury.
21536871 2011 T-cell immunoglobulin and mucin domain 1 (TIM-1) is a receptor for Zaire Ebolavirus and Lake Victoria Marburgvirus.
21513984 2011 Fyn binds to and phosphorylates T cell immunoglobulin and mucin domain-1 (Tim-1).
21467131 2011 High urinary excretion of kidney injury molecule-1 is an independent predictor of end-stage renal disease in patients with IgA nephropathy.
21412435 2011 Gene-trap mutagenesis identifies mammalian genes contributing to intoxication by Clostridium perfringens ?-toxin.
21402675 2011 Urinary kidney injury molecule-1 in patients with IgA nephropathy is closely associated with disease severity.
21378325 2011 HAVcR-1 reduces the integrity of human endothelial tight junctions.
21367814 2011 Polymorphisms of the TIM-1 and TIM-3 genes are not associated with systemic lupus erythematosus in a Chinese population.
21339644 2011 A polymorphism in TIM1 is associated with susceptibility to severe hepatitis A virus infection in humans.
20980978 2011 Regression of microalbuminuria in type 1 diabetes is associated with lower levels of urinary tubular injury biomarkers, kidney injury molecule-1, and N-acetyl-?-D-glucosaminidase.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20819195 2011 Molecular biomarker candidates of acute kidney injury in zero-hour renal transplant needle biopsies.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20549518 2010 Identification of HAVCR1 gene haplotypes associated with mRNA expression levels and susceptibility to autoimmune diseases.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20479636 2010 TIM1 haplotype may control the disease progression to AIDS in a HIV-1-infected female cohort in Thailand.
20447817 2010 Kidney injury molecule-1 (KIM-1): a novel kidney-specific injury molecule playing potential double-edged functions in kidney injury.
20388397 2010 [Expression and clinical significance of kidney injury molecule-1 in renal epithelial neoplasms].
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20304168 2010 Quantitative analyses of kidney injury molecule-1 messenger RNA in kidney transplant recipients with graft dysfunction.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20233133 2010 Combination of urinary kidney injury molecule-1 and interleukin-18 as early biomarker for the diagnosis and progressive assessment of acute kidney injury following cardiopulmonary bypass surgery: a prospective nested case-control study.
20232767 2010 Association between TIM-1 gene polymorphisms and allergic rhinitis in a Han Chinese population.
20070602 2010 Fine mapping of T-cell immunoglobulin mucin domain gene 1 failed to detect a significant association with multiple sclerosis.
19572801 2009 Comparative analysis of urinary biomarkers for early detection of acute kidney injury following cardiopulmonary bypass.
19522876 2009 Kidney injury molecule-1 is an early noninvasive indicator for donor brain death-induced injury prior to kidney transplantation.
19494522 2009 Family-based association study of Tim-1 and Tim-3 gene polymorphisms with childhood asthma in Chinese trios.
19480659 2009 Altered expression of T cell immunoglobulin-mucin (TIM) molecules in bronchoalveolar lavage CD4+ T cells in sarcoidosis.
19476019 2009 Association analysis of TIM-1 -232G > A and 5383_5397 insertion/deletion polymorphisms with childhood asthma and total serum immunoglobulin E levels in middle China.
19424017 2009 TIM-1: a new player in transplant immunity.
19387469 2009 A rapid urine test for early detection of kidney injury.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19173034 2009 Assay validation for KIM-1: human urinary renal dysfunction biomarker.
19167431 2009 Infection and regulation of the immune response.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18802347 2008 Control and regulation of peripheral tolerance in allergic inflammatory disease: therapeutic consequences.
18769021 2008 Kim-1/Tim-1: from biomarker to therapeutic target?
18715847 2008 Kidney injury molecule-1 expression identifies proximal tubular injury in urate nephropathy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18466531 2007 Case-control association analysis of rheumatoid arthritis with candidate genes using related cases.
18453570 2008 T cell Ig and mucin domain-1-mediated T cell activation requires recruitment and activation of phosphoinositide 3-kinase.
18294362 2008 Significant association between TIM1 promoter polymorphisms and protection against cerebral malaria in Thailand.
18273441 2007 Kidney injury molecule 1 (Kim1) is a novel ciliary molecule and interactor of polycystin 2.
18165774 2007 High urinary excretion of kidney injury molecule-1 is an independent predictor of graft loss in renal transplant recipients.
18082433 2007 TIM-1 and TIM-4 glycoproteins bind phosphatidylserine and mediate uptake of apoptotic cells.
18052965 2008 Expression of human TIM-1 and TIM-3 on lymphocytes from systemic lupus erythematosus patients.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17570927 2007 A functional polymorphism in the TIM-1 gene is associated with asthma in a Chinese Han population.
17471468 2007 Tubular kidney injury molecule-1 (KIM-1) in human renal disease.
17371991 2007 Human TIM-1 associates with the TCR complex and up-regulates T cell activation signals.
17229699 2007 Immunoglobulin A (IgA) is a natural ligand of hepatitis A virus cellular receptor 1 (HAVCR1), and the association of IgA with HAVCR1 enhances virus-receptor interactions.
17205356 2007 Ciliary calcium signaling is modulated by kidney injury molecule-1 (Kim1).
17117951 2006 Absence of association between two insertion/deletion coding genetic polymorphisms of TIM-1 gene and asthma in Chinese Han population.
16940744 2006 Genetic association studies between the T cell immunoglobulin mucin (TIM) gene locus and childhood atopic dermatitis.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16481347 2006 Inhibition of in vitro and in vivo T cell responses by recombinant human Tim-1 extracellular domain proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15867855 2005 Genetic variants of the T-cell immunoglobulin mucin 1 but not the T-cell immunoglobulin mucin 3 gene are associated with asthma in an African American population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15300647 2004 [Exploring the possibility of a relationship between polymorphism in TIM-1 and allergic asthma in children of the Hans from Hubei province of China].
15086915 2004 Hepatitis A virus receptor blocks cell differentiation and is overexpressed in clear cell renal cell carcinoma.
15007635 2004 TIM-1, a novel allergy and asthma susceptibility gene.
14637143 2003 The association of the exon 4 variations of Tim-1 gene with allergic diseases in a Korean population.
14630400 2003 Molecular variations in the promoter and coding regions of human Tim-1 gene and their association in Koreans with asthma.
14534576 2003 Immunology: hepatitis A virus link to atopic disease.
12893810 2003 Immune semaphorins: a new area of semaphorin research.
12618867 2003 Insertion/deletion coding polymorphisms in hHAVcr-1 are not associated with atopic asthma in the Japanese population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138159 2002 Shedding of kidney injury molecule-1, a putative adhesion protein involved in renal regeneration.
11725301 2001 Identification of Tapr (an airway hyperreactivity regulatory locus) and the linked Tim gene family.
9658108 1998 The human homolog of HAVcr-1 codes for a hepatitis A virus cellular receptor.
9557657 1998 The Cys-rich region of hepatitis A virus cellular receptor 1 is required for binding of hepatitis A virus and protective monoclonal antibody 190/4.