Property Summary

NCBI Gene PubMed Count 8
PubMed Score 130.89
PubTator Score 32.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.2e-04
ovarian cancer 8491 5.2e-04
lung cancer 4473 1.1e-03
group 3 medulloblastoma 2254 2.6e-03
Multiple myeloma 1327 4.1e-02

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.309 4.1e-02
psoriasis 1.200 2.2e-04
lung cancer 1.400 1.1e-03
group 3 medulloblastoma 1.400 2.6e-03
ovarian cancer 1.500 5.2e-04

 MGI Phenotype (1)

AA Sequence

MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKP      1 - 70
ILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLKIQRRNKCQLMASVTSHKSLRLNAK     71 - 140
EEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQGTNPLVFLSQFSLEKYLSQEEQS    141 - 210
TAALTLYTKKQFFQGIHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLK    211 - 280
ASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVVRENAQLLNMP    281 - 350
VVKGDFDLQIAKQDYYTARQELVLNQLIKQKASFELLQLSYEIELRKHRDIYRQLENLVQELSQSNMMLY    351 - 420
KQLEMLTDPSVSQQINPRNTIDTKDYSTHRLYQVLEGENKKKELFLTHGNLEEVAEKLKQNISLVQDQLA    421 - 490
VSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLNKLNHLLTDILADVKTKRKTL    491 - 560
ANNKLHQMEREFYVYFLKDEDYLKDIVENLETQSKIKAVSLED                               561 - 603
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
19812674 2009 Mutational evolution in a lobular breast tumour profiled at single nucleotide resolution.
19427217 2009 HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369198 2009 The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells.
18443220 2008 Augmin: a protein complex required for centrosome-independent microtubule generation within the spindle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.