Property Summary

NCBI Gene PubMed Count 9
PubMed Score 144.96
PubTator Score 32.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.2e-04
ovarian cancer 8520 5.2e-04
lung cancer 4740 1.1e-03
group 3 medulloblastoma 4104 2.6e-03
Multiple myeloma 1332 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hypotrichosis 1 15 5.406 2.7

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.400 2.6e-03
lung cancer 1.400 1.1e-03
Multiple myeloma 1.309 4.1e-02
ovarian cancer 1.500 5.2e-04
psoriasis 1.200 2.2e-04

 MGI Phenotype (1)

AA Sequence

MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKP      1 - 70
ILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLKIQRRNKCQLMASVTSHKSLRLNAK     71 - 140
EEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQGTNPLVFLSQFSLEKYLSQEEQS    141 - 210
TAALTLYTKKQFFQGIHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLK    211 - 280
ASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVVRENAQLLNMP    281 - 350
VVKGDFDLQIAKQDYYTARQELVLNQLIKQKASFELLQLSYEIELRKHRDIYRQLENLVQELSQSNMMLY    351 - 420
KQLEMLTDPSVSQQINPRNTIDTKDYSTHRLYQVLEGENKKKELFLTHGNLEEVAEKLKQNISLVQDQLA    421 - 490
VSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLNKLNHLLTDILADVKTKRKTL    491 - 560
ANNKLHQMEREFYVYFLKDEDYLKDIVENLETQSKIKAVSLED                               561 - 603
//

Text Mined References (13)

PMID Year Title