Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.79
PubTator Score 9.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 5.2e-19
glioblastoma 1.800 1.4e-08
oligodendroglioma 1.300 1.4e-11
posterior fossa group A ependymoma 1.500 3.7e-08
group 3 medulloblastoma 2.800 6.9e-07
atypical teratoid/rhabdoid tumor 2.000 9.5e-09
medulloblastoma, large-cell 2.000 4.7e-06
primitive neuroectodermal tumor 2.300 6.3e-07
juvenile dermatomyositis 1.187 2.3e-12
pediatric high grade glioma 1.800 1.4e-06
pilocytic astrocytoma 1.200 4.7e-05
nasopharyngeal carcinoma 1.400 2.1e-03
ovarian cancer -1.500 3.4e-06

 GWAS Trait (1)

Gene RIF (1)

PMID Text
15082789 These results place human enhancer of invasion-cluster as a novel regulator of spindle function and integrity during the metaphase-anaphase transition.

AA Sequence

MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAK      1 - 70
YLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIEL     71 - 140
EKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDA    141 - 210
SLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL      211 - 278
//

Text Mined References (17)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19427217 2009 HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity.
19369198 2009 The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells.
18443220 2008 Augmin: a protein complex required for centrosome-independent microtubule generation within the spindle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15232106 2004 Self-assembling protein microarrays.
15082789 2004 Human enhancer of invasion-cluster, a coiled-coil protein required for passage through mitosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.