Property Summary

NCBI Gene PubMed Count 71
PubMed Score 267.31
PubTator Score 328.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

 GO Function (1)

Gene RIF (64)

PMID Text
26722395 HAS2-HA system influences the biological characteristics of human breast cancer cells
26518873 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
25325984 transcriptional regulation of the HAS and HAS2-antisense RNA 1 genes, was analyzed.
25264594 mir-23a-3p causes cellular senescence by targeting hyaluronan synthase 2: possible implication for skin aging.
25251750 Our study identified HAS2 as a novel candidate gene for susceptibility to adult asthma.
25081531 review of the roles of HAS2 and CD44 in breast tumorigenesis [review]
24847057 UDP-glucose activates P2Y14 receptor and JAK2, increases STAT3 Tyr705 phosphorylation, and enhances transcription of HAS2.
24558368 HAS2 may be involved in the etiology of non-syndromic VSD and have the vital function in the development of heart septum
24527698 In contrast to other carcinoma subtypes, HAS2 expression was observed in up to 72.7% of metaplastic carcinomas of breast, a carcinoma subtype related to the epithelial-mesenchymal transition.
24472738 Stimulation with LPS caused rapid increases in versican mRNA and protein, a rapid increase in Has1 mRNA, and concomitant inhibition of hyaluronidases 1 and 2, the major hyaluronan degrading enzymes
24333416 HAS2 knockdown sensitizes cancer cells to radiation via persistent DNA damage.
24314882 Inhibition of miR-21 has no effect on thrombospondin (TSP)-1-stimulated expression of HAS2.
23979132 Data indicate that oxLDL doubled the transcripts of hyaluronan synthases HAS2 and HAS3 and hyaluronan deposition via the scavenger receptor LOX-1.
23916661 findings suggested that rs2046571 of the HSA2 has marginal association with PD in Chinese population.
23806178 Data suggest that expression of HAS2 is lower in trophoblasts from first-trimester placenta of miscarriage then of normal subjects; the products of HAS2 (high/medium MW hyaluronan) promote cell proliferation/invasion and inhibit apoptosis.
23560496 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
23452080 COL6A1 and COL6A2 silencing downregulates HAS2 expression in Down syndrome fibroblasts.
23397370 The results from these experiments suggest that downregulation of HAS2 may be responsible for inhibition of hyaluronate synthesis in the self-assembled 2-nM T3 human dermal matrix.
23303191 Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3
22960332 polymorphisms in HAS2 are potentially involved in glaucomatous neurodegeneration.
22887999 Role of UDP-N-acetylglucosamine (GlcNAc) and O-GlcNAcylation of hyaluronan synthase 2 in the control of chondroitin sulfate and hyaluronan synthesis.
22825838 Melanoma cell-derived factors stimulate hyaluronan synthesis in dermal fibroblasts by upregulating HAS2 through PDGFR-PI3K-AKT and p38 signaling
22742591 no significant difference (P > 0.05) was found between the level of HAS2 synthesized by control cells and NCTC 2544 cells treated with Plantaricin A preparations
22695958 HA chains synthesized by HAS1 and HAS2 contribute to outflow resistance, while hyaluronan produced by HAS3 does not appear to play a significant role.
22529214 analysis of changes in cervical glycosaminoglycan composition during normal pregnancy and preterm birth: Has1 is expressed in preterm birth, while Has2 is induced at term
22473523 HAS 2 may be a potential therapeutic target for the treatment of oral cavity cancer
22404213 Knockdown of hyaluronan synthase 2 (HAS2) by siRNA enhances HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
22298898 We identified a previously unknown downstream target of beta-catenin, HAS2, in prostate cancer
22162480 The difference in control of HAS2 expression allows the activation of one of the mechanisms underlying Graves ophthalmopathy, adipogenesis, to be linked biologically with the second, Hyaluronan overproduction.
22113945 Findings show a critical role of HAS2 in the development of a prometastatic microenvironment.
22016393 Hyaluronan synthase 2 (HAS2) promotes breast cancer cell invasion by suppression of tissue metalloproteinase inhibitor 1 (TIMP-1)
21795679 Altered binding of SP1 and YY1 to the promoter correlated with cellular UDP-N-acetylhexosamines content and inhibition of HAS2 expression.
21743962 HAS2-HYAL2/CD44 system may support spontaneous chemokinesis of human cancer cells through self-degradation of HMW-HA to produce LMW-HA by an autocrine mechanism.
21551265 pulsatile, arterial-like shear stress conditions induced enzyme and hyaluronan effectively, while lower shear stress that continuously changed its direction did not induce any differences in comparison with control cultures not exposed to shear stress.
21357421 transcriptional induction of HAS2-AS1 and HAS2 occurs simultaneously in PTCs and suggest that transcription of the antisense RNA stabilizes or augments HAS2 mRNA expression in these cells via RNA/mRNA heteroduplex formation.
21228273 Hyaluronan synthesis is inhibited by adenosine monophosphate-activated protein kinase through the regulation of HAS2 activity in human aortic smooth muscle cells.
20960509 The combined HAS2-HYAL-1 biomarker detected bladder cancer and significantly predicted its recurrence.
20875124 Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma
20522558 interleukin 1beta and tumor necrosis factors alpha and beta, but not transforming growth factors alpha and beta, strongly induced HA synthesis by NF-kappaB pathway, activating hyaluronan synthase 2
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20072653 Data show that a significant in expression levels of HA synthases (HASs) and hyaluronidases (Hyals) was observed in vitro on stimulation of epithelial ovarian carcinoma cells by gonadotropins.
19577615 Transfection with siHAS2 and siHAS1 showed that mainly HAS1 synthesized high molecular weight HA regulates HT1080 cell motility.
19435493 HAS1, HAS2 and HAS3 expression is not consistently elevated in ovarian carcinomas.
19416972 MED1 and NCoR1 are central for the all-trans-RA induction of the HAS2 gene and CBP dominates its forskolin response
19231585 Hyaluronan synthase (HAS2 and HAS3) and hyaluronan may mediate cellular invasion via changes in MMP-7 expression in SW620 colon carcinoma cells.
18587729 Observational study of gene-disease association. (HuGE Navigator)
17872502 HAS2 plays an important role in regulating hyaluronan synthesis and human embryonic stem cell differentiation.
17611197 Interleukin-1beta stimulation resulted in induction of HAS1 and HAS2 transcription but did not induce phenotypic differentiation or induce hyaluronan coat assembly
17315194 RNA interference-mediated suppression of HAS2 led to a less aggressive phenotype of the breast tumor cells, as assessed by cell growth, both in anchorage-dependent and anchorage-independent cultures.
17307735 explain the induction of HAS2 mRNA by all-trans-retinoic acid and tumor necrosis factor-alpha
16807238 osteopontin-transfected cells express high levels of hyaluronan synthase 2, which is associated with increased HA production and matrix retention and is necessary for tumor cell adhesion to bone marrow endothelial cells and anchorage-independent growth
16786194 The aim of this study was to evaluate how TNF-alpha, IFN-gamma,IL-1beta, and exposition to oxidative stress may modulate HAS activities in normal human skin fibroblasts.
16687630 hyaluronan synthase 2 and TSG-6 have roles in hyaluronan distribution and function in proximal tubular epithelial cells
16603733 Sp1 and Sp3 are principal mediators of HAS2 constitutive transcription
16564133 mRNA for HAS1 is undetectable but HAS3 mRNA can be readily detected in freshly isolated CD133+ as well as in CD133- umbilical cord blood (UCB) cells. mRNA for HAS2 can only be detected in CD133+ progenitor cells.
15922739 Antisense inhibition of HAS2 in osteosarcoma cells inhibits hyaluronan retention and tumorigenicity.
15843373 natural antisense mRNAs of HAS2 may have an important and novel regulatory role in the control of HAS2, hyaluronan biosynthesis, and HA-dependent cell functions
15722343 Has2 gene is a potent primary EGF and all-trans-RA responding gene with a complex regulation
15677552 IL-1beta induction of HAS2 expression involves multiple signaling pathways that act in concert, thus leading to an increase in expression of hyaluronan by jejunum-derived mesenchymal cells
15642402 Fusion with PLAG1 protein in lipoblastoma.
14988410 Base sequence of this gene's promoter is sequenced.
14752026 Upregulation of HAS2 expression via EP(2) and IP receptors might contribute to the accumulation of HA during human atherosclerosis, thereby mediating proatherosclerotic functions of COX2.
14636845 Expression of each hyaluronan synthase isoform is regulated differently by growth factors and cytokines in vascular endothelial cells. Expressed in proliferative membranes from proliferative vitreoretinal diseases. May affect progression of diseases.
11790779 hyaluronan synthase expression in prostate adenocarcinoma cells

AA Sequence

MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQSLFAFLEHRK      1 - 70
MKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGR     71 - 140
DKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQV    141 - 210
CDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCI    211 - 280
SGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQ    281 - 350
QTRWSKSYFREWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK    351 - 420
SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIPVSVWFTILLG    421 - 490
GVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRRKKGQQYDMVLDV            491 - 552
//

Text Mined References (71)

PMID Year Title
26722395 2015 Hyaluronan synthase 2 overexpression is correlated with the tumorigenesis and metastasis of human breast cancer.
26518873 2015 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
25325984 2015 Analysis of human hyaluronan synthase gene transcriptional regulation and downstream hyaluronan cell surface receptor mobility in myofibroblast differentiation.
25264594 2015 miR-23a-3p causes cellular senescence by targeting hyaluronan synthase 2: possible implication for skin aging.
25251750 2014 Genomewide association study identifies HAS2 as a novel susceptibility gene for adult asthma in a Japanese population.
25081531 2014 HAS2 and CD44 in breast tumorigenesis.
24847057 2014 Extracellular UDP-glucose activates P2Y14 Receptor and Induces Signal Transducer and Activator of Transcription 3 (STAT3) Tyr705 phosphorylation and binding to hyaluronan synthase 2 (HAS2) promoter, stimulating hyaluronan synthesis of keratinocytes.
24558368 2014 A novel mutation of Hyaluronan synthase 2 gene in Chinese children with ventricular septal defect.
24527698 2014 Differential expression of hyaluronan synthase 2 in breast carcinoma and its biological significance.
24472738 2014 A rapid increase in macrophage-derived versican and hyaluronan in infectious lung disease.
24333416 2014 Inhibition of HAS2 induction enhances the radiosensitivity of cancer cells via persistent DNA damage.
24314882 2014 Thrombospondin-1-induced vascular smooth muscle cell migration and proliferation are functionally dependent on microRNA-21.
23979132 2013 Oxidized low density lipoprotein (LDL) affects hyaluronan synthesis in human aortic smooth muscle cells.
23916661 2013 Marginal association between SNP rs2046571 of the HAS2 gene and Parkinson's disease in the Chinese female population.
23806178 2013 Hyaluronan up-regulates growth and invasion of trophoblasts in an autocrine manner via PI3K/AKT and MAPK/ERK1/2 pathways in early human pregnancy.
23560496 2013 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
23452080 2013 New insights into the pathobiology of Down syndrome--hyaluronan synthase-2 overexpression is regulated by collagen VI ?2 chain.
23397370 2013 Triiodothyronine (T3) inhibits hyaluronate synthesis in a human dermal equivalent by downregulation of HAS2.
23303191 2013 Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22960332 2012 Genetic association and gene-gene interaction of HAS2, HABP1 and HYAL3 implicate hyaluronan metabolic genes in glaucomatous neurodegeneration.
22887999 2012 Role of UDP-N-acetylglucosamine (GlcNAc) and O-GlcNAcylation of hyaluronan synthase 2 in the control of chondroitin sulfate and hyaluronan synthesis.
22825838 2012 Melanoma cell-derived factors stimulate hyaluronan synthesis in dermal fibroblasts by upregulating HAS2 through PDGFR-PI3K-AKT and p38 signaling.
22742591 2012 The antimicrobial peptide pheromone Plantaricin A increases antioxidant defenses of human keratinocytes and modulates the expression of filaggrin, involucrin, ?-defensin 2 and tumor necrosis factor-? genes.
22695958 2012 Perturbation of hyaluronan synthesis in the trabecular meshwork and the effects on outflow facility.
22529214 2012 Dynamic changes in cervical glycosaminoglycan composition during normal pregnancy and preterm birth.
22473523 2013 Role of hyaluronan synthase 2 to promote CD44-dependent oral cavity squamous cell carcinoma progression.
22298898 2012 Activation of ?-catenin signaling in androgen receptor-negative prostate cancer cells.
22162480 2012 Adipose tissue depot-specific differences in the regulation of hyaluronan production of relevance to Graves' orbitopathy.
22113945 2012 Hyaluronan synthase HAS2 promotes tumor progression in bone by stimulating the interaction of breast cancer stem-like cells with macrophages and stromal cells.
22016393 2011 Hyaluronan synthase 2 (HAS2) promotes breast cancer cell invasion by suppression of tissue metalloproteinase inhibitor 1 (TIMP-1).
21795679 2011 Cellular content of UDP-N-acetylhexosamines controls hyaluronan synthase 2 expression and correlates with O-linked N-acetylglucosamine modification of transcription factors YY1 and SP1.
21743962 2011 Fragmented hyaluronan is an autocrine chemokinetic motility factor supported by the HAS2-HYAL2/CD44 system on the plasma membrane.
21551265 2011 Shear stress increases endothelial hyaluronan synthase 2 and hyaluronan synthesis especially in regard to an atheroprotective flow profile.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
21357421 2011 The human hyaluronan synthase 2 (HAS2) gene and its natural antisense RNA exhibit coordinated expression in the renal proximal tubular epithelial cell.
21228273 2011 Hyaluronan synthesis is inhibited by adenosine monophosphate-activated protein kinase through the regulation of HAS2 activity in human aortic smooth muscle cells.
20960509 2011 Association of hyaluronic acid family members (HAS1, HAS2, and HYAL-1) with bladder cancer diagnosis and prognosis.
20875124 2010 Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma.
20522558 2010 Proinflammatory cytokines induce hyaluronan synthesis and monocyte adhesion in human endothelial cells through hyaluronan synthase 2 (HAS2) and the nuclear factor-kappaB (NF-kappaB) pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20072653 2010 Peritoneal adhesion and angiogenesis in ovarian carcinoma are inversely regulated by hyaluronan: the role of gonadotropins.
19577615 2009 bFGF induces changes in hyaluronan synthase and hyaluronidase isoform expression and modulates the migration capacity of fibrosarcoma cells.
19435493 2009 Expression of hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in serous ovarian carcinomas: inverse correlation between HYAL1 and hyaluronan content.
19416972 2009 Regulation of the hyaluronan synthase 2 gene by convergence in cyclic AMP response element-binding protein and retinoid acid receptor signaling.
19231585 2009 Inhibition of hyaluronan synthases decreases matrix metalloproteinase-7 (MMP-7) expression and activity.
18587729 Further evidence for the association of MMP9 with nephropathy in type 2 diabetes and application of DNA pooling technology to candidate gene screening.
17872502 2007 Putative role of hyaluronan and its related genes, HAS2 and RHAMM, in human early preimplantation embryogenesis and embryonic stem cell characterization.
17611197 2007 Involvement of hyaluronan in regulation of fibroblast phenotype.
17324121 2007 Growth factor regulation of hyaluronan synthesis and degradation in human dermal fibroblasts: importance of hyaluronan for the mitogenic response of PDGF-BB.
17315194 2007 Silencing of hyaluronan synthase 2 suppresses the malignant phenotype of invasive breast cancer cells.
17307735 2007 Integration of the activation of the human hyaluronan synthase 2 gene promoter by common cofactors of the transcription factors retinoic acid receptor and nuclear factor kappaB.
16807238 2006 Osteopontin induction of hyaluronan synthase 2 expression promotes breast cancer malignancy.
16786194 2006 TNF-alpha, IFN-gamma, and IL-1beta modulate hyaluronan synthase expression in human skin fibroblasts: synergistic effect by concomital treatment with FeSO4 plus ascorbate.
16687630 2006 Overexpression of hyaluronan synthase 2 alters hyaluronan distribution and function in proximal tubular epithelial cells.
16603733 2006 Sp1 and Sp3 mediate constitutive transcription of the human hyaluronan synthase 2 gene.
16564133 2006 Expression of hyaluronan synthase genes in umbilical cord blood stem/progenitor cells.
15922739 2005 Antisense inhibition of hyaluronan synthase-2 in human osteosarcoma cells inhibits hyaluronan retention and tumorigenicity.
15843373 2005 Natural antisense mRNAs to hyaluronan synthase 2 inhibit hyaluronan biosynthesis and cell proliferation.
15722343 2005 The human hyaluronan synthase 2 gene is a primary retinoic acid and epidermal growth factor responding gene.
15677552 2005 Regulation of hyaluronan synthase-2 expression in human intestinal mesenchymal cells: mechanisms of interleukin-1beta-mediated induction.
15642402 2005 PLAG1-HAS2 fusion in lipoblastoma with masked 8q intrachromosomal rearrangement.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14988410 2004 Identification and analysis of the promoter region of the human hyaluronan synthase 2 gene.
14752026 2004 Induction of hyaluronic acid synthase 2 (HAS2) in human vascular smooth muscle cells by vasodilatory prostaglandins.
14636845 Expression of hyaluronan synthase in intraocular proliferative diseases: regulation of expression in human vascular endothelial cells by transforming growth factor-beta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790779 2002 Manipulation of hyaluronan synthase expression in prostate adenocarcinoma cells alters pericellular matrix retention and adhesion to bone marrow endothelial cells.
10093717 1999 Mammalian hyaluronan synthases: investigation of functional relationships in vivo.
9169154 1997 Chromosomal localization of the human and mouse hyaluronan synthase genes.
8798477 1996 Molecular identification of a putative human hyaluronan synthase.