Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.83
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96MB7 D3DQP9
Symbols C11orf77

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPE      1 - 70
TQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAG     71 - 140
MPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSS    141 - 210
QFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGA    211 - 280
LQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS     281 - 349
//

Text Mined References (8)

PMID Year Title