Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.58
PubTator Score 5.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.500 2.2e-02
atypical teratoid / rhabdoid tumor -1.700 1.2e-05
ependymoma -2.200 1.8e-12
glioblastoma -1.200 4.9e-03
group 3 medulloblastoma -2.200 1.4e-02
medulloblastoma, large-cell -2.100 1.1e-04
primitive neuroectodermal tumor -1.300 1.1e-03
progressive supranuclear palsy -1.100 1.9e-02
psoriasis -1.800 2.6e-13
subependymal giant cell astrocytoma -1.340 4.4e-02

Gene RIF (5)

AA Sequence

MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRW      1 - 70
SKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVA     71 - 140
LTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLT    141 - 210
ARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYA    211 - 280
AWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN              281 - 340
//

Text Mined References (10)

PMID Year Title