Property Summary

NCBI Gene PubMed Count 37
PubMed Score 138.95
PubTator Score 74.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
urothelial carcinoma 1.700 5.0e-02
malignant mesothelioma 4.500 7.2e-09
oligodendroglioma 2.500 1.1e-02
osteosarcoma 4.319 6.8e-03
posterior fossa group A ependymoma 2.700 2.1e-06
sonic hedgehog group medulloblastoma -1.900 1.4e-04
non diabetic and post-ischemic heart fai... 1.300 1.2e-02
type II diabetes mellitus and post-ische... 1.800 4.5e-02
glioblastoma -1.200 1.5e-02
medulloblastoma, large-cell -2.400 3.4e-05
active Crohn's disease 1.855 1.9e-02
ulcerative colitis -1.185 3.2e-02
X-linked cerebral adrenoleukodystrophy 4.100 6.1e-03
colon cancer -1.200 2.6e-03
Breast cancer 3.700 4.5e-02
interstitial cystitis -1.100 1.9e-02
atypical teratoid/rhabdoid tumor 1.400 4.7e-02
ovarian cancer 1.300 1.5e-08
psoriasis -1.100 3.8e-10

Gene RIF (13)

PMID Text
23748413 CSGalNAcT-1 and Hapln-1 may play important roles in the pathogenesis of Kashin-Beck disease and osteoarthritis.
22159717 HAPLN1 is overexpressed in metastatic melanoma and is secreted exclusively by the tumor cells
20953637 Single-nucleotide polymorphism in the hyaluronan and proteoglycan link protein 1 (HAPLN1) gene is associated with spinal osteophyte formation and disc degeneration in Japanese women.
20953637 Observational study of gene-disease association. (HuGE Navigator)
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20584105 An in vitro model of perineuronal nets has been developed demonstrating that cartilage link protein (along with hyaluronan synthase) are necessary for their formation.
20453000 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19556317 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19351750 Overexpression of HAPLN1 and its SP-IgV domain increases tumorigenic properties of mesothelioma. Thus, targeting the SP-IgV domain may be one of the therapeutic approaches in cancer treatment.
15590670 cLP and versican did not bind directly to each other in solution yet formed ternary complexes with hyaluronan
15456769 SOX9 is a key regulator of CRTL1
14724283 link protein may function as a stabilizer of the interaction between aggrecan and hyaluronan in cartilage and between versican and hyaluronan in many tissues

AA Sequence

MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAF      1 - 70
GSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCE     71 - 140
VIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWL    141 - 210
SDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACL    211 - 280
NDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCF    281 - 350
RAYN                                                                      351 - 354
//

Text Mined References (39)

PMID Year Title
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23748413 2013 Abnormal expression of chondroitin sulphate N-acetylgalactosaminyltransferase 1 and Hapln-1 in cartilage with Kashin-Beck disease and primary osteoarthritis.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22159717 2012 The matrisome: in silico definition and in vivo characterization by proteomics of normal and tumor extracellular matrices.
22138694 2011 A genome-wide association study in Han Chinese identifies new susceptibility loci for ankylosing spondylitis.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20953637 2011 Single-nucleotide polymorphism in the hyaluronan and proteoglycan link protein 1 (HAPLN1) gene is associated with spinal osteophyte formation and disc degeneration in Japanese women.
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
20584105 2010 In vitro modeling of perineuronal nets: hyaluronan synthase and link protein are necessary for their formation and integrity.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19556317 2009 Glypican 5 is an interferon-beta response gene: a replication study.
19351750 2009 Protumorigenic role of HAPLN1 and its IgV domain in malignant pleural mesothelioma.
17903305 2007 A genome-wide association study of breast and prostate cancer in the NHLBI's Framingham Heart Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15590670 2005 Expression and purification of functionally active hyaluronan-binding domains from human cartilage link protein, aggrecan and versican: formation of ternary complexes with defined hyaluronan oligosaccharides.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456769 2004 SOX9-dependent and -independent transcriptional regulation of human cartilage link protein.
14724283 2004 Link protein has greater affinity for versican than aggrecan.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12888576 2003 Distinct interaction of versican/PG-M with hyaluronan and link protein.
12663660 2003 A hyaluronan binding link protein gene family whose members are physically linked adjacent to chondroitin sulfate proteoglycan core protein genes: the missing links.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429048 2002 Production of cartilage link protein by human granulosa-lutein cells.
11493848 2001 Fibrocartilage in the transverse ligament of the human atlas.
11038300 2000 Glycation induced crosslinking of link proteins, in vivo and in vitro.
11027579 2000 The brain link protein-1 (BRAL1): cDNA cloning, genomic structure, and characterization as a novel link protein expressed in adult brain.
10198161 1999 Refined genetic and physical localization of the Wagner disease (WGN1) locus and the genes CRTL1 and CSPG2 to a 2- to 2.5-cM region of chromosome 5q14.3.
9712087 1998 Autoimmunity to cartilage link protein in patients with rheumatoid arthritis and ankylosing spondylitis.
7945259 1994 Human link protein gene: structure and transcription pattern in chondrocytes.
7694569 1993 Matrix metalloproteinases cleave at two distinct sites on human cartilage link protein.
2738916 1989 Immunoglobulin fold and tandem repeat structures in proteoglycan N-terminal domains and link protein.
2336413 1990 The primary structure of human cartilage link protein.
2320422 1990 The primary structure of human cartilage link protein.
2286376 1990 Complete amino acid sequence of human cartilage link protein (CRTL1) deduced from cDNA clones and chromosomal assignment of the gene.
2030970 1991 Characterization of the promoter for the rat and human link protein gene.
1725805 1991 Distribution of cartilage proteoglycan (aggrecan) core protein and link protein gene expression during human skeletal development.