Property Summary

NCBI Gene PubMed Count 35
PubMed Score 147.53
PubTator Score 82.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.500 3.0e-02
lung cancer 1.100 1.5e-02
malignant mesothelioma 4.100 4.3e-09
medulloblastoma, large-cell 1.200 3.9e-05
osteosarcoma 1.105 2.9e-03

Gene RIF (21)

AA Sequence

MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAAT      1 - 70
AYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLAT     71 - 140
SYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWA    141 - 210
LELNQ                                                                     211 - 215
//

Text Mined References (35)

PMID Year Title