Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 2.6e-04
atypical teratoid / rhabdoid tumor -1.300 3.7e-10
Breast cancer 1.100 2.0e-14
group 4 medulloblastoma -1.500 5.3e-06
non primary Sjogren syndrome sicca 1.300 1.7e-02

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLR      1 - 70
PGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAG     71 - 140
CGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKARPLSRRGKR    141 - 210
VGGEGTGFGVGGALRQGLMVTGACGHSRRGMRMTCPLCRRLWARSASTTPSCGWREYGCCPGASTVTWTL    211 - 280
RKASGDCVLG                                                                281 - 290
//

Text Mined References (8)

PMID Year Title