Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.319 1.4e-02
ependymoma 2.100 4.0e-13
gastric carcinoma -1.700 1.6e-02
non primary Sjogren syndrome sicca 1.200 2.2e-02
osteosarcoma -1.077 3.6e-03

AA Sequence

MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYKTNSSHYGEFL      1 - 70
PIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHTL                        71 - 121
//

Text Mined References (3)

PMID Year Title