Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.33186358553102E-15
osteosarcoma 7933 0.00356346310094947
active Crohn's disease 918 0.0138649816265635
gastric carcinoma 832 0.0160040989594753
non primary Sjogren syndrome sicca 840 0.0217057335486002

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.077 0.004
posterior fossa group B ependymoma 2.700 0.000
active Crohn's disease 1.319 0.014
non primary Sjogren syndrome sicca 1.200 0.022
gastric carcinoma -1.700 0.016

AA Sequence

MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYKTNSSHYGEFL      1 - 70
PIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHTL                        71 - 121
//

Text Mined References (3)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.