Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.838 4.6e-04

AA Sequence

MLSKGRSPRRKQVQTQRKAALVLSVTPMVPVGSVWLAMSSVLSAFMRELPGWFLFFGVFLPVTLLLLLLI      1 - 70
AYFRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKWT                                      71 - 107
//

Text Mined References (6)

PMID Year Title