Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession H3BPM6
Symbols C3orf83
MKRN2-AS1

Gene

 Compartment GO Term (0)

AA Sequence

MHCAEAGKALIKFNHCEKYIYSFSVPQCCPLCQQDLGSRKLEDAPVSIANPFTNGHQEKCSFLLRPTQGT      1 - 70
FLREYDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAW     71 - 140
LPHRYEDNHHNCYSYALTFINCVLMAEGRQQLDKGEFTEKYVVPRTRLASKFITLYRAIREHGFYVTDCP    141 - 210
QQQAQPPEGGGLC                                                             211 - 223
//

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.