Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession H3BNL8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MANSRFSCTQIWVKMYGYFAGLCRRLQKFWRVTVKGFFVKKKEKKIPSAETYFHEEKIVVLGQVLMNESL      1 - 70
PIEKRAQAAQKIGLLAFTGGPPAGNFAAEYMEEVAHLLQDEELAPKIKILLLQSVACWCYLNPVSQKRAK     71 - 140
SLQFIPILISFFEGRFESTIKSETNSYLLLKFWTCYVLSVMTCNNLSCVKELKDHSALKYHLQMLAAENW    141 - 210
SGWTENFAEVLYFLIGFHRN                                                      211 - 230
//

Text Mined References (1)

PMID Year Title
14574404 2003 The DNA sequence and analysis of human chromosome 6.