Property Summary

NCBI Gene PubMed Count 0
PubMed Score 4.04

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK                   71 - 126
//

Text Mined References (17)

PMID Year Title