Property Summary

NCBI Gene PubMed Count 77
PubMed Score 304.45
PubTator Score 181.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.409 7.5e-03
Multiple myeloma 1.503 8.2e-03
psoriasis 1.500 1.4e-04
adrenocortical carcinoma 1.416 1.1e-07
intraductal papillary-mucinous neoplasm ... 1.100 3.3e-02
lung cancer 2.100 3.6e-04
breast carcinoma 1.500 6.7e-06
diabetes mellitus -1.100 2.0e-02
Breast cancer 4.900 2.2e-02
group 3 medulloblastoma 1.200 1.2e-02
Endometriosis 1.136 1.5e-02
ductal carcinoma in situ 1.300 1.4e-03
invasive ductal carcinoma 1.600 3.8e-04
ovarian cancer 1.900 5.7e-03
dermatomyositis 1.400 3.9e-03

Gene RIF (43)

PMID Text
26974126 The 2.7-A-resolution crystal structure of the human YL1-H2A.Z-H2B complex shows that YL1 binding, similarly to ANP32E binding, triggers an extension of the H2A.Z alphaC helix.
26833946 Results suggest that the N-terminal tail of H2A.Z makes distinctively different contributions to epigenetic events.
26246156 the H2AFZ gene may confer a risk for schizophrenia and contribute to the impairment of executive function in Han Chinese patients with schizophrenia.
26142279 H2A.Z removal from chromatin is the primary function of INO80 and ANP32E in promoting homologous recombination.
26051178 The findings implicate H2A.Z.2 as a mediator of cell proliferation and drug sensitivity in malignant melanoma.
26034280 Dynamic modulation of H2A.Z exchange and removal by Anp32e reveals the importance of the nucleosome surface and nucleosome dynamics in processing the damaged chromatin template during DSB repair.
25392085 Results demonstrated male-selective association of the H2AFZ gene with schizophrenia, and that modification of the H2AFZ signaling pathway warrants further study in terms of the pathophysiology of schizophrenia
24613878 Anp32e may help to resolve the non-nucleosomal H2A.Z aggregates and also facilitate the removal of H2A.Z at the +1 nucleosomes, and the latter may help RNA polymerase II to pass the first nucleosomal barrier.
24397596 the predictive values regarding low expressions of H2AFZ and CASP8AP2 and high white blood cell count suggest that these features could help to identify more accurately patients at greater risk of relapse.
24311584 A mutational analysis revealed that the amino-acid difference at position 38 is at least partially responsible for the structural polymorphism in the L1 loop region of H2A.Z.1 and H2A.Z.2.
24240188 Depletion of H2A.Z in the osteosarcoma U2OS cell line and in immortalized human fibroblasts does not change parameters of DNA double-strand breaks repair while affecting clonogenic ability and cell cycle distribution.
24127549 Sirt1 and H2A.Z deregulation in prostate cancer are related. Epigenetic mechanisms, mostly histone post-translational modifications, are likely involved and impair sirt1-mediated downregulation of H2A.Z via proteasome-mediated degradation.
23349794 Data show that histone deacetylase inhibitors (HDACi) induce p21 transcription and reduce cell proliferation of MDA-MB231, an ERalpha-negative mammary tumor cell line, in a H2A.Z dependent manner.
23324626 SETD6 monomethylates H2AZ on lysine 7.
23245330 Data indicate that histone H2A.Z as a protein capable of binding ST1926 specifically.
23146670 age-dependent p400 downregulation and loss of H2A.Z localisation may contribute to the onset of replicative senescence through a sustained high rate of p21 transcription
23122415 H2A.Z exchange promotes specific patterns of histone modification and reorganization of the chromatin architecture, leading to the assembly of a chromatin template that is an efficient substrate for the DNA double-strand break repair machinery.
23108396 H2A.Z-dependent crosstalk between enhancer and promoter regulates cyclin D1 expression.
23064015 incorporation of the histone variant H2A.Z at the promoter regions of PPARgamma target genes by p400/Brd8 is essential to allow fat cell differentiation
23034477 Study mapped H2A.Z genome-wide in embryonic stem cells and neural progenitors; H2A.Z is deposited at promoters and enhancers, and correlates strongly with H3K4 methylation. H2A.Z is present at poised promoters with bivalent chromatin and at active promoters with H3K4 methylation, but is absent from stably repressed promoters that are enriched for H3K27 trimethylation.
22678762 ZNF24 may be implicated in transcriptional regulation of genes associated with oncogenesis via interaction with H2A.Z.
22493515 The short forms of H2A.Z in both yeast and human cells are more loosely associated with chromatin than the full-length proteins, indicating a conserved function for the H2A.Z C-terminal tail in regulating the association of H2A.Z with nucleosomes.
22393239 nucleosomes containing H2AZ are primarily composed of H4 K12ac and H3 K4me3 but not H3 K36me3
21788347 acetylation of H2A.Z is a key modification associated with gene activity in normal cells and epigenetic gene deregulation in tumorigenesis.
20864037 H2A.Z is maintained during mitosis and marks the +1 nucleosome of active genes, which shifts during mitosis, resulting in occupancy at the transcriptional start site and a reduced nucleosome-depleted region.
20364108 This review provides a brief overview of H2A.Z biology and presents hypotheses that could reconcile contradictory reports that are found in the literature regarding the influence of H2A.Z on nucleosome stability.
20023423 Eesterogen Receptor alpha directly associates to the H2A.Z promoter, and consequently modulates its expression.
19856965 Both H2A.Z and H3.3 affect nucleosome positioning, either creating new positions or altering the relative occupancy of the existing nucleosome position space. Only H2A.Z-containing nucleosomes exhibit altered linker histone binding.
19834540 show that upon gene induction, human H2A.Z associates with gene promoters and helps in recruiting the transcriptional machinery.
19515975 H2A.Z is incorporated into the promoter regions of estrogen receptor (ERalpha) target genes only upon gene induction, and that, in a cyclic pattern
19385636 The nucleosome destabilizing effect of H2A.Z acetylation takes place synergistically with the acetylation of the rest of the core histones.
19261190 Both genetic and epigenetic features are likely to participate in targeting H2A.Z to distinct chromatin loci.
19246569 Results show that H2A.Z nucleosomes protect only approximately 120 bp of DNA from MNase digestion and exhibit specific sequence preferences, suggesting a novel mechanism of nucleosome organization for the H2A.Z variant.
18414489 histone variant H2A.Z is associated with breast cancer progression
17671089 Upon DNA damage, histone H2A.Z is first evicted from the p21 promoter, followed by the recruitment of the Tip60 histone acetyltransferase to activate p21 transcription.
17636032 Monoubiquitylation of H2A.z distinguishes its association with euchromatin or facultative heterochromatin.
17194760 identify the essential histone variant H2A.Z as a new structural component of the centromere
16809769 neither H2AZ itself nor other features of the H2AZ-containing nucleosome spread to the neighboring nucleosomes in vivo, arguing against a role for H2AZ as a self-perpetuating epigenetic mark
15878876 chromatin remodeling at the c-myc gene involves the local exchange of histone H2A.Z
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA      1 - 70
GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV                 71 - 128
//

Text Mined References (79)

PMID Year Title
26974126 2016 Molecular basis and specificity of H2A.Z-H2B recognition and deposition by the histone chaperone YL1.
26833946 2016 Genetic complementation analysis showed distinct contributions of the N-terminal tail of H2A.Z to epigenetic regulations.
26246156 2015 Association of common variants in H2AFZ gene with schizophrenia and cognitive function in patients with schizophrenia.
26142279 2015 Removal of H2A.Z by INO80 promotes homologous recombination.
26051178 2015 Histone Variant H2A.Z.2 Mediates Proliferation and Drug Sensitivity of Malignant Melanoma.
26034280 2015 Histone chaperone Anp32e removes H2A.Z from DNA double-strand breaks and promotes nucleosome reorganization and DNA repair.
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
25392085 2015 Association study of H2AFZ with schizophrenia in a Japanese case-control sample.
25362550 2015 A comprehensive view of the epigenetic landscape part I: DNA methylation, passive and active DNA demethylation pathways and histone variants.
24613878 2014 Anp32e, a higher eukaryotic histone chaperone directs preferential recognition for H2A.Z.
24463511 2014 ANP32E is a histone chaperone that removes H2A.Z from chromatin.
24397596 2014 Significance of CASP8AP2 and H2AFZ expression in survival and risk of relapse in children with acute lymphoblastic leukemia.
24311584 2013 Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2.
24240188 2014 H2A.Z depletion impairs proliferation and viability but not DNA double-strand breaks repair in human immortalized and tumoral cell lines.
24127549 2013 Regulation of histone H2A.Z expression is mediated by sirtuin 1 in prostate cancer.
23637611 2013 TIP48/Reptin and H2A.Z requirement for initiating chromatin remodeling in estrogen-activated transcription.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23349794 2013 Activation of p21 by HDAC inhibitors requires acetylation of H2A.Z.
23324626 2013 SETD6 monomethylates H2AZ on lysine 7 and is required for the maintenance of embryonic stem cell self-renewal.
23245330 2013 New insights into the molecular mechanisms underlying sensitivity/resistance to the atypical retinoid ST1926 in acute myeloid leukaemia cells: the role of histone H2A.Z, cAMP-dependent protein kinase A and the proteasome.
23146670 Decrease of p400 ATPase complex and loss of H2A.Z within the p21 promoter occur in senescent IMR-90 human fibroblasts.
23122415 2012 Histone H2A.Z controls a critical chromatin remodeling step required for DNA double-strand break repair.
23108396 2013 H2A.Z-dependent crosstalk between enhancer and promoter regulates cyclin D1 expression.
23064015 2012 The p400/Brd8 chromatin remodeling complex promotes adipogenesis by incorporating histone variant H2A.Z at PPAR? target genes.
23034477 2012 H2A.Z landscapes and dual modifications in pluripotent and multipotent stem cells underlie complex genome regulatory functions.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22678762 2012 A yeast two-hybrid screen identifies histone H2A.Z as a transcription factor ZNF24 interactor.
22493515 2012 A conserved function for the H2A.Z C terminus.
22393239 2012 Single-molecule tools elucidate H2A.Z nucleosome composition.
21788347 2012 Acetylation of H2A.Z is a key epigenetic modification associated with gene deregulation and epigenetic remodeling in cancer.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20864037 2010 H2A.Z maintenance during mitosis reveals nucleosome shifting on mitotically silenced genes.
20473270 2010 Essential role of p18Hamlet/SRCAP-mediated histone H2A.Z chromatin incorporation in muscle differentiation.
20364108 2010 Reconciling the positive and negative roles of histone H2A.Z in gene transcription.
20299344 2010 Identification and characterization of the two isoforms of the vertebrate H2A.Z histone variant.
20023423 2010 H2A.Z overexpression promotes cellular proliferation of breast cancer cells.
20003410 2009 Characterization of the histone H2A.Z-1 and H2A.Z-2 isoforms in vertebrates.
19856965 2009 H2A.Z and H3.3 histone variants affect nucleosome structure: biochemical and biophysical studies.
19834540 2009 The euchromatic and heterochromatic landscapes are shaped by antagonizing effects of transcription on H2A.Z deposition.
19633671 2009 H3.3/H2A.Z double variant-containing nucleosomes mark 'nucleosome-free regions' of active promoters and other regulatory regions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19515975 2009 Histone H2A.Z is essential for estrogen receptor signaling.
19385636 2009 Acetylation of vertebrate H2A.Z and its effect on the structure of the nucleosome.
19261190 2009 Discriminating nucleosomes containing histone H2A.Z or H2A based on genetic and epigenetic information.
19246569 2009 Comparative analysis of H2A.Z nucleosome organization in the human and yeast genomes.
18414489 2008 Genomic analysis of estrogen cascade reveals histone variant H2A.Z associated with breast cancer progression.
17671089 2007 p21 transcription is regulated by differential localization of histone H2A.Z.
17636032 2007 Monoubiquitylation of H2A.Z distinguishes its association with euchromatin or facultative heterochromatin.
17194760 2007 H2A.Z contributes to the unique 3D structure of the centromere.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16809769 2006 Analysis of human histone H2AZ deposition in vivo argues against its direct role in epigenetic templating mechanisms.
16627869 2006 Quantitative proteomic analysis of post-translational modifications of human histones.
16457589 2006 Precise characterization of human histones in the H2A gene family by top down mass spectrometry.
16319397 2006 Characterization of histone H2A and H2B variants and their post-translational modifications by mass spectrometry.
15878876 2005 Transcription-induced chromatin remodeling at the c-myc gene involves the local exchange of histone H2A.Z.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759373 2004 CTCF tethers an insulator to subnuclear sites, suggesting shared insulator mechanisms across species.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
12660166 2003 Pericentric heterochromatin becomes enriched with H2A.Z during early mammalian development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11835281 2002 Histone ubiquitination: a tagging tail unfolds?
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11516949 2001 Histone variant H2A.Z is required for early mammalian development.
11380948 2001 Evidence for a novel polymorphism affecting both N-linked glycosylation and ligand binding of the IgG receptor IIIB (CD16).
11331621 2001 Histone H2A variants and the inactive X chromosome: identification of a second macroH2A variant.
11157489 2001 B-cell development in progressively transformed germinal centers: similarities and differences compared with classical germinal centers and lymphocyte-predominant Hodgkin disease.
11101893 2000 Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
11059755 2000 BCL-6 mutations are associated with immunoglobulin variable heavy chain mutations in B-cell chronic lymphocytic leukemia.
10975868 2000 Coronary arteries from human cardiac allografts with chronic rejection contain oligoclonal T cells: persistence of identical clonally expanded TCR transcripts from the early post-transplantation period (endomyocardial biopsies) to chronic rejection (coronary arteries).
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
8605251 1996 An upstream region of the H2AZ gene promoter modulates promoter activity in different cell types.
8020992 1994 Chromosomal mapping of the human histone gene H2AZ to 4q24 by fluorescence in situ hybridization.
7880446 1995 Characterization of the proximal promoter of the human histone H2A.Z gene.
7821789 1994 Construction of a human full-length cDNA bank.
3344202 1988 Sequence of cDNAs for mammalian H2A.Z, an evolutionarily diverged but highly conserved basal histone H2A isoprotein species.
1697587 1990 The human histone H2A.Z gene. Sequence and regulation.