Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession H0YM25
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLMWPQPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNP      1 - 70
SVGTAASDTKKKKINNGTSPETTTSGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMAL     71 - 140
YYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVTTQKKKADRYIEELTKERDALSLELYRNTITD    141 - 210
EELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKLQAQVE    211 - 280
ENELWNRLNQQQEEKMWRQEEKIQEWEEKIQEQEEKIREQEEKIREQEEKMRRQEEMMWEKEEKMRRQEE    281 - 350
MMWEKEEKIRELEEKMHEQEKIREQEEKRQEEEKIREQEKRQEQEAKMWRQEEKIREQEEKIREQEKKMW    351 - 420
RQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQEEKIRKQEEKVWRQEEKMHDQEE    421 - 490
KIREQEEKVWRQEEKIREQEKKREQEEKMWRQEEKIREQEEKIREQEEMWREEEKMHEQEKIWEEEKRQE    491 - 560
QEDKMWRQEEKIREQEEKVWRQEEKIREQEEKRQEQEEKMWKQEEKIREQEEKIREQEEKIREQEEKIRE    561 - 630
QEEMMQEQEEKMGEQEEKMQEQEKMRRQEEKIREQEEKIREQKEKIREQEEKIWEQEEKIREQEEMMQEQ    631 - 700
EEKMGEQEEKIWEQEEKMQEQEEKMRRQEEKIREQEKKIREQEEKIREQEEMMQEQEEKMGEQEEKMQEQ    701 - 770
EEKMRRQEEKIREQEKKIREQEEKIREQEEMMQEQEEKMWEQEEKMCEQEEKMQEQEEKMRRQEEKMWEQ    771 - 840
EVRLRQQEEKMQEH                                                            841 - 854
//

Text Mined References (3)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.