Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.36
PubTator Score 3.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.234 2.2e-09
hepatocellular carcinoma -1.300 2.8e-06
medulloblastoma, large-cell -1.300 1.3e-03
osteosarcoma -1.097 1.0e-04
ovarian cancer 1.900 1.4e-04
tuberculosis and treatment for 6 months 1.100 4.2e-04

Gene RIF (4)

AA Sequence

MESGAVLLESKSSPFNLLHEMHELRLLGHLCDVTVSVEYQGVRKDFMAHKAVLAATSKFFKEVFLNEKSV      1 - 70
DGTRTNVYLNEVQVADFASFLEFVYTAKVQVEEDRVQRMLEVAEKLKCLDLSETCFQLKKQMLESVLLEL     71 - 140
QNFSESQEVEVSSGSQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSSDLPPKKSKDKLDKKKE    141 - 210
VVKPPYPKIRRASGRLAGRKVFVEIPKKKYTRRLREQQKTAEGDVGDYRCPQDQSPDRVGTEMEQVSKNE    211 - 280
GCQAGAELEELSKKAGPEEEEEEEEEDEEGEKKKSNFKCSICEKAFLYEKSFLKHSKHRHGVATEVVYRC    281 - 350
DTCGQTFANRCNLKSHQRHVHSSERHFPCELCGKKFKRKKDVKRHVLQVHEGGGERHRCGQCGKGLSSKT    351 - 420
ALRLHERTHTGDRPYGCTECGARFSQPSALKTHMRIHTGEKPFVCDECGARFTQNHMLIYHKRCHTGERP    421 - 490
FMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVHTGERPYCCDQCGKQFTQLN    491 - 560
ALQRHRRIHTGERPFMCNACGRTFTDKSTLRRHTSIHDKNTPWKSFLVIVDGSPKNDDGHKTEQPDEEYV    561 - 630
SSKLSDKLLSFAENGHFHNLAAVQDTVPTMQENSSADTACKADDSVVSQDTLLATTISELSELTPQTDSM    631 - 700
PTQLHSLSNME                                                               701 - 711
//

Text Mined References (10)

PMID Year Title